KEGG   Cylindrospermum stagnale: Cylst_0563Help
Entry
Cylst_0563        CDS       T02398                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
csg  Cylindrospermum stagnale
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cylst_0563
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cylst_0563
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cylst_0563
Enzymes [BR:csg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cylst_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(622277..623368)
Genome map
AA seq 363 aa AA seqDB search
MTLSLSTAKSYRQPWPGLIEAYREYLPVSEHTPVVTLLEGNTPLIPAPAIAERIGRQVRV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMNAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDQALEIVREMAESYPITLVNSVNPYRLEGQKTG
AFEIVDALGDAPDWLCIPVGNAGNITAYWMGFCQYHQAGKCDRLPRMMGFQAAGAAPLVH
GQPVAHPETLATAIRIGNPASWEKAIAAQSASQGSFKAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLQVKDQVPTGATVVCILTGNGLKDPDTAIKHSHSQFKQGIPAELKAVAEA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcctgtctactgcaaaatcttatcgccaaccctggcccggtctgatagaa
gcctatcgtgaatatttgcctgtcagtgaacacacccctgttgtcactctattggagggt
aatactcccctgataccggcgccggcgatcgcagaacgcattggccgacaagtaagggtg
tttgtcaaatatgacggtcttaaccccactggaagctttaaagaccggggaatgacaatg
gcaatttctaaggctaaggaagcaggcgcgaaggcggtaatttgtgccagtacgggcaat
acctctgccgctgccgctgcttatgctaggcgtggaggtatgaatgcctttgtgctgatt
cccgatggttatgtggccctgggtaaattagcccaggctctactttatggggcagaggtg
ctggctattaaaggaaattttgaccaagcgctggaaattgtccgcgaaatggccgaaagt
tatccgatcactttggtcaattcggtgaatccctaccgcttagaagggcagaaaaccgga
gcatttgaaattgtggatgctttgggtgacgccccagattggctgtgcatccccgtaggt
aatgcgggtaatatcacagcatattggatgggtttttgtcaatatcatcaagcaggaaag
tgcgatcgcttaccccggatgatgggtttccaagcagccggtgcagccccgttagtacat
ggtcagccagtggcccatccagaaactttagctacagcgattcgcattggcaatccggct
agctgggaaaaagcgatcgccgctcaatcagctagtcaaggaagcttcaaggctgtgact
gatgaagaaattctcgatgcttatcgacttttggcatcatcagaagggattttttgtgaa
cctgccagtgctgcttctgtcgcagggctattgcaggttaaagaccaagttccgactggt
gcaacagtggtttgtattctcaccggcaatggtctcaaagacccggatacagcgattaaa
catagtcatagtcaatttaaacagggtatccccgcagaactcaaagcagtagctgaggca
atgggattttaa

DBGET integrated database retrieval system