KEGG   Cylindrospermum stagnale: Cylst_0563Help
Entry
Cylst_0563        CDS       T02398                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00260  Glycine, serine and threonine metabolism
csg00750  Vitamin B6 metabolism
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
csg01120  Microbial metabolism in diverse environments
csg01230  Biosynthesis of amino acids
Module
csg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cylst_0563
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cylst_0563
Enzymes [BR:csg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cylst_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFZ22898
UniProt: K9WRR2
Position
complement(622277..623368)
Genome map
AA seq 363 aa AA seqDB search
MTLSLSTAKSYRQPWPGLIEAYREYLPVSEHTPVVTLLEGNTPLIPAPAIAERIGRQVRV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMNAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDQALEIVREMAESYPITLVNSVNPYRLEGQKTG
AFEIVDALGDAPDWLCIPVGNAGNITAYWMGFCQYHQAGKCDRLPRMMGFQAAGAAPLVH
GQPVAHPETLATAIRIGNPASWEKAIAAQSASQGSFKAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLQVKDQVPTGATVVCILTGNGLKDPDTAIKHSHSQFKQGIPAELKAVAEA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcctgtctactgcaaaatcttatcgccaaccctggcccggtctgatagaa
gcctatcgtgaatatttgcctgtcagtgaacacacccctgttgtcactctattggagggt
aatactcccctgataccggcgccggcgatcgcagaacgcattggccgacaagtaagggtg
tttgtcaaatatgacggtcttaaccccactggaagctttaaagaccggggaatgacaatg
gcaatttctaaggctaaggaagcaggcgcgaaggcggtaatttgtgccagtacgggcaat
acctctgccgctgccgctgcttatgctaggcgtggaggtatgaatgcctttgtgctgatt
cccgatggttatgtggccctgggtaaattagcccaggctctactttatggggcagaggtg
ctggctattaaaggaaattttgaccaagcgctggaaattgtccgcgaaatggccgaaagt
tatccgatcactttggtcaattcggtgaatccctaccgcttagaagggcagaaaaccgga
gcatttgaaattgtggatgctttgggtgacgccccagattggctgtgcatccccgtaggt
aatgcgggtaatatcacagcatattggatgggtttttgtcaatatcatcaagcaggaaag
tgcgatcgcttaccccggatgatgggtttccaagcagccggtgcagccccgttagtacat
ggtcagccagtggcccatccagaaactttagctacagcgattcgcattggcaatccggct
agctgggaaaaagcgatcgccgctcaatcagctagtcaaggaagcttcaaggctgtgact
gatgaagaaattctcgatgcttatcgacttttggcatcatcagaagggattttttgtgaa
cctgccagtgctgcttctgtcgcagggctattgcaggttaaagaccaagttccgactggt
gcaacagtggtttgtattctcaccggcaatggtctcaaagacccggatacagcgattaaa
catagtcatagtcaatttaaacagggtatccccgcagaactcaaagcagtagctgaggca
atgggattttaa

DBGET integrated database retrieval system