KEGG   Cylindrospermum stagnale: Cylst_0595Help
Entry
Cylst_0595        CDS       T02398                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
csg  Cylindrospermum stagnale
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cylst_0595
Enzymes [BR:csg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cylst_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660358..660996
Genome map
AA seq 212 aa AA seqDB search
MISYLKGLVAGVQTISPNRTILTLEVNSMGYDLQIPQRLGRQLTTIGQEVQIFTHYQIRE
EVPLLYGFASPAERDLFRHLLTVSGIGAASAIALLDTLEVPDLVQAIIAANTQILIQAPG
VGKKTAERICLELKSKLIEWRKSAGFFVATGGPAPGILEEVQMTLFALGYTAHEVSHALH
VVSENIGLTKDAYVEDWIKQAIAHLSSTEVES
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctatcttaaaggtcttgtcgctggcgtccaaaccattagtccgaatcgcacg
attctgactttagaggtgaatagtatggggtatgatttacaaattccccaacgactcggc
cggcaattaacgacgattgggcaagaggtacaaatttttacccattaccaaattcgcgaa
gaagtgccgttgctatacggctttgcttcgccagcagaacgagatttatttcgtcactta
ctaactgtcagcggtattggtgcagcttcggcgatcgcacttttggacactttggaagtg
ccagatttagtccaggcaattattgcggctaatacccaaattttaattcaagctcctggt
gtgggcaagaaaaccgctgaacgcatctgtttggaactgaaaagcaagttgatcgagtgg
cgcaaatcagcaggcttcttcgtcgctactggtggcccagcaccagggattttagaagaa
gtgcaaatgactctctttgctttgggatatactgcccatgaagtcagtcacgccctgcac
gttgtcagtgaaaacatcggattaaccaaagatgcctatgtggaagattggattaaacaa
gcgatcgcacatcttagcagcactgaagttgaatcttga

DBGET integrated database retrieval system