KEGG   Cylindrospermum stagnale: Cylst_0693Help
Entry
Cylst_0693        CDS       T02398                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
csg  Cylindrospermum stagnale
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:csg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(784416..785123)
Genome map
AA seq 235 aa AA seqDB search
MTIASSNGSNRAQSPLNPDLAEAINPRPDRNTHDGREPVLLSPTEENKEQMMEAARTLLL
GVGEDPEREGLLKTPKRMAEALLFLTSGYDQSLEELVNGAIFDEGHNEMVLVRDINFFSL
CEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAIQTVLEPQ
GVAVVMEATHMCMAMRGVQKPGSWTVTSAMVGLFQEEQKTREEFFNLIRHQGSFF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgctagttctaacggttctaatcgcgctcaatctcctcttaatcccgatttg
gcagaagctatcaatcctagacccgaccgtaatacccacgacggacgagaaccagttttg
ctctcgccaacagaggaaaataaagagcaaatgatggaagccgcgcggacactgctatta
ggcgttggcgaagaccccgaacgcgaaggactcctgaaaacacccaagcgcatggctgag
gcactgctgtttcttaccagtggctacgaccaatccttggaagaactcgttaatggtgcc
atctttgatgaagggcataatgagatggtactagttagagatattaatttctttagcctg
tgtgaacatcatatgctgccatttatgggcagagcgcacgttgcttatattcctaaccaa
aaagttgtgggactgagtaagctggcccgcattgtcgagatgtattcccggcgcttgcaa
gtacaggaaaggctaacccgccaaattgccgaagcaattcagaccgttttggaacctcag
ggcgtcgccgttgtgatggaagctacccatatgtgcatggcaatgcgaggtgttcagaaa
ccaggttcttggactgttaccagtgcaatggttggtttgttccaagaagagcaaaaaacc
cgcgaagaattctttaacttaattcgccaccaaggatctttcttttag

DBGET integrated database retrieval system