KEGG   Cylindrospermum stagnale: Cylst_0980Help
Entry
Cylst_0980        CDS       T02398                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
csg  Cylindrospermum stagnale
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cylst_0980
   00052 Galactose metabolism
    Cylst_0980
   00500 Starch and sucrose metabolism
    Cylst_0980
   00520 Amino sugar and nucleotide sugar metabolism
    Cylst_0980
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cylst_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1139370..1140260)
Genome map
AA seq 296 aa AA seqDB search
MRQNKVRKAVIPAAGFGTRLFPATKVVKKELFPIIDQDGRAKPVILAIVEEAISAGIAEV
GIVVQPDDQEIFQDLFKHPPKPEFFAKLSPQNQEYSQYLQDLGSKITILTQATQEGYGHA
VFCAKDWVQNEPFLLMLGDHVYASNIEKSSTRQVLDVYEKVNHSVIGLTTMPAEIIHKAG
CVTGVWQELNSLLSLTQIYEKPTVEYARQHLRVEGMALDEFLCMFGLYLLTPQIFDFLAE
QINQNFRERGEFQLTSCLERLRQAEGITGYMVKGKCFDTGLPDAYRQTMIDFRNVS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaaaataaagtcagaaaagctgtaattcccgctgcggggtttggtacacgctta
tttcctgctaccaaagttgtcaaaaaagaacttttcccaattattgatcaagatggcagg
gcaaagcctgtgattttagcaattgtggaagaagcaatcagcgccggaattgccgaagtt
gggattgtagtgcaaccggatgaccaagaaatttttcaagatttatttaaacatccaccc
aaaccagaatttttcgccaaactatcgccgcaaaatcaagaatatagccaatatctccaa
gatttaggtagcaagattacaattttaacccaagcaacacaagaaggctatggacacgca
gtattttgcgctaaagattgggtgcaaaatgagccatttctgctgatgctaggcgaccat
gtttatgcatcaaatatagaaaaatcctctactagacaagttttagatgtatatgaaaaa
gttaatcatagcgtaattggcttaacgacgatgccagcagaaattattcataaagctggg
tgtgtcaccggagtttggcaagagttaaactcgctgctttccctcacccaaatatatgag
aagccaactgttgaatatgcccgccagcacttacgtgtagaaggtatggcactcgatgaa
tttttatgtatgtttggtttatatttactaacgccgcaaatttttgattttttggcagaa
cagatcaatcaaaattttcgagaaagaggcgaatttcagctaacatcctgtcttgagaga
ttacgtcaagccgaaggcataactggatatatggtcaaaggtaagtgttttgatacggga
ttaccagatgcttatcggcagacgatgattgattttagaaatgtgagttaa

DBGET integrated database retrieval system