KEGG   Cylindrospermum stagnale: Cylst_1233Help
Entry
Cylst_1233        CDS       T02398                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csg  Cylindrospermum stagnale
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cylst_1233
Enzymes [BR:csg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cylst_1233
Exosome [BR:csg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cylst_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1422348..1424639)
Genome map
AA seq 763 aa AA seqDB search
MSMTTIAPEQVNRIVWNQHHDPFEILGSHPIDQNGKTVWAVRAYLPNASAAWVVVPEERK
EYPMQAVHDPHFFECIIETAELTNYQLRIKEGDHERVTYDPYAFHSPRLTDFDLHLFAEG
NHHRIYEKLGAHLTEVEGVKGVYFAVWAPNARNVSLLGDFNFWDGRKHQMRKGQTGIWEL
FIPELGAGEHYKYEIKNFEGHIYEKSDPYGFQQEARPKTASIVTDLTVHNWGDEDWMETR
RHTDPLTQPVSVYEVHLGSWLHASSGEPAKLPNGETEAVVPVSELNPGARFLTYRELADK
LIPYVKEMGYTHLELLPIAEHPFDGSWGYQVTGYFAPTSRFGSPEDFMYFVDQCHQNGIG
VIVDWVPGHFPKDGHGLAFFDGSHLYEHADPRKGEHKEWGTLVFNYNRHEVKNFLVANAI
FWFDKYHIDGIRVDAVASMLYLDYCRKPGEWLPNQYGGRENLEAADFLRQVNHLLFSYFP
GVLSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKLANVRCLFSYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWHLFQYEPHQQLKQFFQDLNHLYRSEPALYTLDFAQEGFEWIDCSD
NRHSVVSFVRRDKDADNFAIVVCNFTPQPHSHYRIGVPEKGFYTELFNSDARQYGGSNMG
NLGGKWTDDWSLHNRPYSLDLCLPPLGVLILKLDKQKTAAVME
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaccacgatcgcccctgaacaggttaaccgcatcgtttggaatcagcatcat
gatccgtttgaaatactgggttctcatcccatagaccaaaatggtaaaactgtctgggct
gtgcgagcctacttaccaaatgcgagtgccgcgtgggtagtagttcctgaagaacgcaaa
gaatatcccatgcaagcagtgcatgatccccacttttttgaatgcattattgaaaccgca
gaactgacaaactaccagttacggattaaagaaggggatcatgagcgagtcacttacgac
ccttacgccttccattctccccgcttgacagactttgatttgcatttgtttgctgaaggt
aaccatcaccgaatttacgagaaactaggagcacacctcacggaagtagagggcgttaaa
ggcgtttattttgctgtttgggcacccaatgcccgtaatgtctccctgctgggggatttc
aacttctgggacgggcgcaaacaccaaatgcgtaaaggacaaaccggcatttgggagttg
tttattcctgaactgggtgcgggtgaacattacaaatatgaaatcaaaaattttgaaggt
cacatttacgaaaaatccgatccctacggtttccagcaggaagcccgccccaaaaccgca
tccattgttactgacttaactgtccacaactggggcgacgaagattggatggagacacgg
cgtcacaccgaccccctcacccaacctgtatccgtctacgaagtgcatttaggctcttgg
ttgcacgcttctagtggagaaccagctaaactgcccaatggggaaactgaagctgtagtt
cccgtttctgaactaaaccctggcgcccgctttcttacctatcgggaattagcagacaag
ctcattccctatgtgaaagaaatgggatacactcatctggaactgctgccaatcgccgaa
catccctttgatggttcttggggttatcaagtaactggctactttgcccccacttcccgt
tttggtagccctgaagattttatgtattttgttgaccaatgtcaccaaaatggtattggc
gtgattgtcgattgggttcccggccacttccccaaagatgggcatggtttagctttcttt
gatggtagtcacctttacgaacacgctgatcctcgcaaaggcgaacataaagaatggggg
actctagtattcaactacaatcgccacgaagtgaaaaacttcctggtagccaatgccatt
ttctggtttgataagtaccacattgacggaattcgcgttgatgctgtagcctcaatgctc
taccttgactattgccgcaaaccaggagaatggttgcccaatcagtacggcggtagagaa
aacttggaagcagcggatttcttacgtcaggtaaatcacctgctcttcagttatttcccc
ggcgttctctcaattgccgaagaatccacttcttggccaatggtatcttggcctacctac
acaggtggactgggctttaacttaaagtggaatatgggctggatgcacgatatgctggac
tacttcagcatggacccttggttccgccagtttcaccaaaacaatatcacctttagtatg
tggtataaccacagcgaaaactttatgctggctctgtcccacgatgaggtggtgcatggc
aagagcaatattatcggtaaaatgccgggggatagatggcagaagctcgctaatgtgcgt
tgtttgtttagctatatgttcgctcaccctggcaagaaaaccatgtttatgagcatggag
tttggccagtggagtgagtggaatgtctgggctgatttggagtggcatttattccagtat
gagccgcatcaacagttgaaacagtttttccaagatttaaaccatctctaccgttctgaa
ccagcgttgtacactctggattttgctcaggaagggtttgagtggattgactgtagcgat
aaccgccatagtgtagtttccttcgttcgacgcgataaggatgctgacaattttgcgatc
gtggtttgcaattttacaccgcaaccccattctcactatcgaattggtgtaccagaaaag
ggattttatactgagttgttcaatagcgatgctcgtcaatatggcggtagcaatatgggc
aatttaggcggtaagtggactgatgattggtctttgcacaatcgtccttattcactagat
ttgtgtttacctcctttgggtgtgttgattctcaagttagataagcagaagacagcagca
gtgatggaataa

DBGET integrated database retrieval system