KEGG   Cylindrospermum stagnale: Cylst_1257Help
Entry
Cylst_1257        CDS       T02398                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
csg  Cylindrospermum stagnale
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cylst_1257
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cylst_1257
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cylst_1257
Enzymes [BR:csg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cylst_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444918..1446222
Genome map
AA seq 434 aa AA seqDB search
MTQATTTDAQATTAILQALKCKECGEEYELKASHVCELCFGPLEVKYNYSNLRLSVSREK
IQAGPNSIWRYRDFLPVLTDNVIDVGTGMTPLVRSHRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKILGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWQL
PDHIVAPLASGSLFTKIYKGFQEFVEVGLVEAKDVRFSGAQAEGCSPIAQAYKEGRDFIK
PVKPNTIAKSIAIGNPADGVYAMEIARKTNGNIESVNDAEIIEGIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAIQDYVGEPLTIDAKLDSFERALER
SQTLNRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcaacaaccacagacgcccaagcaacgactgccatattgcaagccttgaag
tgtaaggaatgtggcgaggaatatgaactcaaagccagccatgtttgtgagttgtgcttt
ggtccgttagaagtcaaatataactacagcaacctgcgtctctctgtcagtcgggaaaaa
atccaagccgggccaaattcaatttggcgctaccgggactttttgcctgtcctcactgat
aacgtgatcgatgtgggaacaggtatgactcccttggttcgttcccatcgtcttgcccgt
cgcctgggtttaaataagctttatattaaaaatgatgccgtcaacatgcccactctcagc
tttaaagatcgagtggtgtctgtcgccctctctagagccagagaattgggtttcacaact
gtttcttgcgctagcacaggtaacctggcaaactctacagctgcgatcgcagcacatgcc
ggtttagactgctgtgtgttcatccccgcagacttggaagcgggtaaaattctgggtagc
ctcatctacagccctaccctgatggcagtcaagggcaactacgatcaagtaaatcgcctc
tgctcggaagtcgccaatacacacggctggggttttgtcaatattaacctgcgtccttac
tactcagaaggttccaagacactgggttttgaagttgcagaacaactcggttggcaacta
cctgaccatatcgttgctcctttggcttctggttccctgtttaccaaaatctataagggt
ttccaagaatttgtcgaagtcggtttagtggaagctaaggatgtgcgtttcagtggcgct
caagctgaaggctgttcacccattgcccaagcatacaaagaagggcgcgactttatcaag
ccagtgaaaccgaatacaattgccaaatcaattgcgatcggcaacccagcagacggtgtt
tacgctatggaaatagcccggaagactaacggtaatattgaatcagtcaatgatgcagaa
attattgaaggtatcaagttactagcagaaaccgaaggcatctttactgaaaccgccggc
ggtacaacagttgctgtgctgaaaaaattggtagaagctggcaaaattgatccagatgaa
actaccgtggtttatatcactggcaatggtttaaaaacccaagaagccatccaagactac
gttggtgaacctttgacaattgatgccaaactcgatagctttgaacgggcactagaaaga
tcccaaacactcaaccgcctagaatggcagcaagtcctcgtttag

DBGET integrated database retrieval system