KEGG   Cylindrospermum stagnale: Cylst_1575Help
Entry
Cylst_1575        CDS       T02398                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
csg  Cylindrospermum stagnale
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cylst_1575
Enzymes [BR:csg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cylst_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1842552..1843601
Genome map
AA seq 349 aa AA seqDB search
MSNQIQDYNPSSVGEKNGNLLGLPFNYESANLIVFAVPWEVTVSYGAGTANGPQQILDAS
VQLDLFDFDHPDGWKQGIFLVEIPQDILDKNKYYRAEATKIIERLAEGKQLTDTPDLTPV
LTEINQACQQVNQWLFTQSQAAINNGKQVAVIGGDHSSPLGYFQALATKYANFGILHIDA
HADLRDAYEGFEFSHGSIMFNGLKIPQISKLVQVGVRDICHDEVQLINQSNNRIVAYYDT
AIKQKLYSGATWIDICREIISHLPEYVYISFDADGLDPKLCPSTGTPVPGGLELEQTFCL
FRELVNSGRKIIGFDLCEVGDAEWDGNVGARIVYKLANLLDLSQKQFSN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaatccaggactacaaccccagcagcgtcggtgaaaaaaatggtaatctc
cttggtttaccttttaattacgagtctgcaaacctgattgttttcgctgtaccgtgggaa
gtcactgtttcctatggcgctggtaccgccaacgggccgcagcaaattttggatgcttcg
gtgcaactggatttgttcgattttgatcatcctgatggctggaaacagggaatttttttg
gtagaaattccccaagatatcttagataaaaataaatattatcgcgccgaagctaccaaa
attattgaacgactggcagaaggtaaacaactgacagatacaccagatttaacacctgtg
ctgacagaaattaatcaagcttgtcaacaggtgaatcaatggctgtttacccagtctcaa
gcagcaattaacaatggtaaacaagttgcagtcattggtggtgatcacagttcaccttta
ggatatttccaagcattagccactaaatatgcaaattttggcattttgcacatagatgcc
catgcagacttacgcgatgcttatgagggatttgagttttctcatggatcaatcatgttt
aatgggttaaaaatcccgcaaatctctaaattagtgcaagtaggagtgcgggatatttgc
catgatgaagtacaactaattaaccaatcaaataatcgaattgtggcttattacgataca
gctatcaaacaaaaactttattctggggcgacttggattgatatctgtcgagaaattatc
agtcatttacctgagtatgtttacattagctttgatgctgatggtttagatcctaaactt
tgcccaagtacaggtacacctgtccctggtggactggaattagagcagactttttgttta
tttcgggagttggtaaatagtgggagaaagattataggttttgatctctgcgaagttggt
gatgctgagtgggatgggaatgtgggggccaggattgtttataagctggcgaatttgcta
gatttatcgcagaaacaatttagcaattga

DBGET integrated database retrieval system