KEGG   Cylindrospermum stagnale: Cylst_1575Help
Entry
Cylst_1575        CDS       T02398                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
csg  Cylindrospermum stagnale
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:csg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1842552..1843601
Genome map
AA seq 349 aa AA seqDB search
MSNQIQDYNPSSVGEKNGNLLGLPFNYESANLIVFAVPWEVTVSYGAGTANGPQQILDAS
VQLDLFDFDHPDGWKQGIFLVEIPQDILDKNKYYRAEATKIIERLAEGKQLTDTPDLTPV
LTEINQACQQVNQWLFTQSQAAINNGKQVAVIGGDHSSPLGYFQALATKYANFGILHIDA
HADLRDAYEGFEFSHGSIMFNGLKIPQISKLVQVGVRDICHDEVQLINQSNNRIVAYYDT
AIKQKLYSGATWIDICREIISHLPEYVYISFDADGLDPKLCPSTGTPVPGGLELEQTFCL
FRELVNSGRKIIGFDLCEVGDAEWDGNVGARIVYKLANLLDLSQKQFSN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaatccaggactacaaccccagcagcgtcggtgaaaaaaatggtaatctc
cttggtttaccttttaattacgagtctgcaaacctgattgttttcgctgtaccgtgggaa
gtcactgtttcctatggcgctggtaccgccaacgggccgcagcaaattttggatgcttcg
gtgcaactggatttgttcgattttgatcatcctgatggctggaaacagggaatttttttg
gtagaaattccccaagatatcttagataaaaataaatattatcgcgccgaagctaccaaa
attattgaacgactggcagaaggtaaacaactgacagatacaccagatttaacacctgtg
ctgacagaaattaatcaagcttgtcaacaggtgaatcaatggctgtttacccagtctcaa
gcagcaattaacaatggtaaacaagttgcagtcattggtggtgatcacagttcaccttta
ggatatttccaagcattagccactaaatatgcaaattttggcattttgcacatagatgcc
catgcagacttacgcgatgcttatgagggatttgagttttctcatggatcaatcatgttt
aatgggttaaaaatcccgcaaatctctaaattagtgcaagtaggagtgcgggatatttgc
catgatgaagtacaactaattaaccaatcaaataatcgaattgtggcttattacgataca
gctatcaaacaaaaactttattctggggcgacttggattgatatctgtcgagaaattatc
agtcatttacctgagtatgtttacattagctttgatgctgatggtttagatcctaaactt
tgcccaagtacaggtacacctgtccctggtggactggaattagagcagactttttgttta
tttcgggagttggtaaatagtgggagaaagattataggttttgatctctgcgaagttggt
gatgctgagtgggatgggaatgtgggggccaggattgtttataagctggcgaatttgcta
gatttatcgcagaaacaatttagcaattga

DBGET integrated database retrieval system