KEGG   Cylindrospermum stagnale: Cylst_1817Help
Entry
Cylst_1817        CDS       T02398                                 

Definition
PAS domain S-box
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
csg  Cylindrospermum stagnale
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:csg02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:csg02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2096913..2098808
Genome map
AA seq 631 aa AA seqDB search
MTTLEKDPEFENLLVYLRQSRGFDFSGYKRSTLMRRVNKRLQIFNLERFGDYMDYLEVYP
DEFNNLFNTILINVTGFFRDTAAWEQLAEKVLPDIVNSKKDSAPIRMWSAGCASGEEAYT
LAMLMAEIMGVEEFRQRVKIYASDVDEEALNQARLAVYSAKDVQAVPEELRQKYFEASGN
NYVFRQDLRRSVIFGRHDLFQDAPISRLDLLVCRNTLMYFNTEVQGRILARFHFALNNNS
YLFLGKAEMLLLHSNLFTPIDLKNRIFTKVAVPNTRDRLLVMANTGDDEVSNRLTRHLRI
REQAFDLAPIAQIVVDVKGTLVLVNEKARTLFSLSPKDLARPFQDLELSYRPIELRSLIE
KAYTDRRPVALANVERYLPNAEIKYLDVQIVPLQDGDNSLIGVSITFNDVTRYNQLHQDL
KRYRLDLESSNEELQSTNEELETTNEELQSTNEELETTNEELQSTNEELETMNEELQSAN
EELVTINNELSQRTVELNHSNVFLVSILRSLQAGIVVIDQNSNILIWNYLVEDLWGLRTD
EVVGKSIFSLDIGLPMEQLRAAIRDSLSGQNQFEEMILDAVNRRGKQIKCYVAVTPLFGM
EVEGVVVMMADIDKINSMVSLQDIEQRRRQQ
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgactactctagaaaaagaccctgaatttgaaaatctacttgtttatctgagacaaagc
cggggctttgatttttcaggctataagcgctcaacgttgatgcgtcgggtaaataagcgg
ttgcagatatttaatctagagcgctttggggattacatggactatctggaagtctatcca
gacgagttcaataatctgttcaacaccatcctgatcaacgttacaggcttttttcgggat
accgcagcttgggaacaactagcagagaaagtgctgcccgatatagttaatagtaaaaaa
gattctgctcctatccggatgtggagcgctggttgtgcctctggtgaggaggcttatact
ctggcaatgctgatggcagaaattatgggagtagaggaatttcgccaacgggtgaaaatc
tatgcctcagatgtagatgaagaagcgctcaaccaagctcgtctagctgtgtattcagcc
aaagatgtccaggctgtgccagaggaactgcgacagaaatattttgaggcatcagggaac
aactatgttttccgccaagacttgcgccgttcagtgatttttggtcgccatgacttgttt
caagatgcgccgatttcccgcttagacctgctggtgtgtcgcaacacactgatgtatttt
aatactgaggttcaggggcggattttggctcgctttcattttgcgctgaataacaacagt
tatctgtttttggggaaagcagagatgctgttgttgcatagcaatctgtttacgccaatt
gacttgaaaaatcgcatatttacgaaagtagcggtgccgaatacacgcgatcgccttttg
gtgatggcaaatacaggggatgatgaggttagcaaccgtttaacgcggcacctccgcatc
cgcgaacaagcttttgatttggcaccgatcgctcaaatagtggttgatgtcaaaggcact
ctcgtgctagttaacgagaaggcgcggactttgtttagtctgtcacccaaagatttagct
cgtcccttccaagatttggaactctcctatcgtccaatagaattgcgatcgctaattgaa
aaagcatataccgatcgccgtcccgttgcgctggcaaatgtagagcgctatttgcccaat
gcagaaattaaatatctggatgtgcaaattgtgcctttgcaagatggcgataacagcctg
atcggcgttagcatcaccttcaatgatgtcacccgctacaatcaacttcatcaagatcta
aaacgctaccgactagatttagagtccagcaacgaagaactgcaatctaccaatgaagaa
ttagaaaccaccaacgaagaactccagtctaccaacgaagaattagaaaccaccaacgaa
gaactccagtctaccaacgaagaattggagacgatgaacgaagaactccagtcggcgaat
gaggaattagtcacaattaataatgaattgagtcagcgcactgtcgaactcaatcactca
aatgtcttcctagtttccatcctcagaagtcttcaagctggaattgtcgtcattgatcaa
aactctaatatcttaatttggaattatttggtggaggatctgtggggtttgcggactgat
gaagtagtcggcaaatctatcttcagtctagacataggtttacctatggagcaactgcga
gcggctatccgtgattccttgtctggacaaaatcaatttgaagaaatgattctcgatgcc
gtcaatcgtcggggcaagcagattaaatgttatgttgcagtcacacccctgtttggtatg
gaagtggagggggtagttgtgatgatggcagatatagacaaaattaacagtatggtttcc
ctccaagatattgagcaacgccgacggcagcaatag

DBGET integrated database retrieval system