KEGG   Cylindrospermum stagnale: Cylst_1879Help
Entry
Cylst_1879        CDS       T02398                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
csg  Cylindrospermum stagnale
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cylst_1879
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cylst_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188393..2189343)
Genome map
AA seq 316 aa AA seqDB search
MRSYSLIAPAKINLYLEIIGDRPDGYHELAMILQSIDLADQIEVRSLSTDNIRVHCHHPQ
VPTDKSNLAYRAAELMATQFPDAFSNYGGVEITIKKQIPVAAGLAGGSTNAAAVLVGIDL
LWHLGLTQSELEELGATLGSDVPFCIAGGTAIATGRGEQLAPLPNLAPIHLVLAKYRSLE
VSTPWAYKTYRQQFGSTYIRDSDNLAARASAVHSGAIVKAILNQDAAEISQKLHNDLERV
VLPAYPQVLQLRELFATQPGVLGTMMSGSGPTVFAIAQSLQLAEAIKLNVRQAIPDEDLE
LFVTRTTTHGIQIVPI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcttacagtttaattgcccctgccaaaatcaacttgtatctagaaatcattggc
gatcgccccgatggctatcatgagttagccatgatactccaaagcatcgaccttgcagac
caaattgaagtgcgttcccttagcactgataatatccgtgttcactgccaccacccccaa
gtaccgacagataaaagtaatctggcataccgagcagccgaactgatggcgacgcaattt
cctgacgcctttagcaattatggcggtgtagaaattacgatcaaaaagcaaattccggtt
gctgctgggttggctggaggttcgacgaatgccgcagcagtattggtggggatagattta
ctctggcatctggggttaactcagtcagaattagaggaactgggtgctactctcggttca
gatgtgcccttttgtattgctgggggaacagcgatcgctacaggtagaggtgaacaactt
gctcccctgccaaatttagcgcccatacatctagtattggcgaaataccgcagcttggaa
gtttccacaccatgggcgtacaaaacctatcggcagcagtttggtagtacttatattaga
gatagcgacaatttggcagcccgtgccagtgcagtccattcaggcgcgattgtcaaagca
atcctcaatcaagatgcggcagaaatctcccaaaaactacacaatgatttagagcgggtg
gtgttgccagcttatccccaagtcttgcaactacgggaattatttgccactcaaccaggg
gttttgggaacaatgatgtctggttctggtccgacagtatttgcgatcgcccaatctcta
caacttgcagaagcaattaagctaaacgtgcgacaggcaattcctgacgaggatttagaa
ttgtttgtgacgcggacgactacacatggaattcaaatagtaccaatctaa

DBGET integrated database retrieval system