KEGG   Cylindrospermum stagnale: Cylst_1947Help
Entry
Cylst_1947        CDS       T02398                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
csg01130  Biosynthesis of antibiotics
csg01230  Biosynthesis of amino acids
Module
csg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cylst_1947
Enzymes [BR:csg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cylst_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFZ24194
UniProt: K9WWK6
Position
2286210..2287109
Genome map
AA seq 299 aa AA seqDB search
MQIRRRSPSQAIDVSILRYQIALPDSAPRNILEEIVWQKEIEVAQMREKLPLHELQKKLP
SAPPTRDFVAALRPGKTKPALIAEVKKASPSKGIFRPDFDPVAIALSYQQGGASCLSVLT
DVKFFQGSFENLSLVRAAVDLPLLCKDFVIYPYQMYWARIHGADAVLLIAAILSDQDLQY
FVKIANKLNMASLIEVHSLAELDRVLALDGVSLVGINNRNLEDFSVDLQTTCQLLADRNK
QLQERNILVVSESGLHHPEDINLVDKAGASAVLIGESLVKQPDPSVGITNLFGKSSSPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgtcgtcgttcgccgagccaagctattgatgtttccatattgcgctatcag
attgccctgccagattcagcacccagaaatattttggaagaaattgtgtggcaaaaagaa
atagaagttgcccaaatgcgggaaaagctgcctttgcatgaattacagaaaaagttaccc
tcagcaccaccaacccgtgattttgtggcggctctacgtccaggtaaaaccaaaccagcg
ctgattgcagaagtgaaaaaagcttctcccagcaaagggattttccgcccagattttgac
ccagtagcgatcgctttatcctaccaacaaggtggcgccagttgtctctccgtactgaca
gatgtcaaattctttcaaggtagctttgaaaacttatccctagttcgcgctgccgtagat
ttgcccctactgtgtaaagattttgtcatctatccttaccagatgtattgggcgcgaatt
catggtgcagatgccgttttgttaattgcagccatcctcagcgatcaagatttgcagtac
ttcgtcaaaattgccaacaaactaaacatggcttcgttgattgaagtccacagcttggca
gaacttgaccgagtattagccttagatggtgtctctttagtgggaatcaataatcgcaac
ttagaagatttctcagttgacttgcaaactacttgtcaactactcgccgataggaataaa
cagttgcaagaacgcaacattttagtagttagtgagtcaggactgcatcacccagaagat
atcaatttagtagacaaagcaggtgcatccgctgtacttattggtgaatccttagtaaaa
caaccagaccccagcgtagggattactaatctcttcggcaaatcttcttcccctgcttaa

DBGET integrated database retrieval system