KEGG   Cylindrospermum stagnale: Cylst_1947Help
Entry
Cylst_1947        CDS       T02398                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
csg  Cylindrospermum stagnale
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:csg01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:csg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2286210..2287109
Genome map
AA seq 299 aa AA seqDB search
MQIRRRSPSQAIDVSILRYQIALPDSAPRNILEEIVWQKEIEVAQMREKLPLHELQKKLP
SAPPTRDFVAALRPGKTKPALIAEVKKASPSKGIFRPDFDPVAIALSYQQGGASCLSVLT
DVKFFQGSFENLSLVRAAVDLPLLCKDFVIYPYQMYWARIHGADAVLLIAAILSDQDLQY
FVKIANKLNMASLIEVHSLAELDRVLALDGVSLVGINNRNLEDFSVDLQTTCQLLADRNK
QLQERNILVVSESGLHHPEDINLVDKAGASAVLIGESLVKQPDPSVGITNLFGKSSSPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgtcgtcgttcgccgagccaagctattgatgtttccatattgcgctatcag
attgccctgccagattcagcacccagaaatattttggaagaaattgtgtggcaaaaagaa
atagaagttgcccaaatgcgggaaaagctgcctttgcatgaattacagaaaaagttaccc
tcagcaccaccaacccgtgattttgtggcggctctacgtccaggtaaaaccaaaccagcg
ctgattgcagaagtgaaaaaagcttctcccagcaaagggattttccgcccagattttgac
ccagtagcgatcgctttatcctaccaacaaggtggcgccagttgtctctccgtactgaca
gatgtcaaattctttcaaggtagctttgaaaacttatccctagttcgcgctgccgtagat
ttgcccctactgtgtaaagattttgtcatctatccttaccagatgtattgggcgcgaatt
catggtgcagatgccgttttgttaattgcagccatcctcagcgatcaagatttgcagtac
ttcgtcaaaattgccaacaaactaaacatggcttcgttgattgaagtccacagcttggca
gaacttgaccgagtattagccttagatggtgtctctttagtgggaatcaataatcgcaac
ttagaagatttctcagttgacttgcaaactacttgtcaactactcgccgataggaataaa
cagttgcaagaacgcaacattttagtagttagtgagtcaggactgcatcacccagaagat
atcaatttagtagacaaagcaggtgcatccgctgtacttattggtgaatccttagtaaaa
caaccagaccccagcgtagggattactaatctcttcggcaaatcttcttcccctgcttaa

DBGET integrated database retrieval system