KEGG   Cylindrospermum stagnale: Cylst_2466Help
Entry
Cylst_2466        CDS       T02398                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
csg  Cylindrospermum stagnale
Brite
Enzymes [BR:csg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Cylst_2466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2 KSR1-SAM
Motif
Other DBs
NCBI-ProteinID: AFZ24681
UniProt: K9WY03
Position
2894331..2895029
Genome map
AA seq 232 aa AA seqDB search
MIELYYWATPNGHKITIFLEEAGLPYKIIPVNIGAGDQFKPEFLKISPNNRIPAIVDNEP
ATGGAPISVFESGAILLYLAEKTGKFIPQDLPGRVEVLQWLFWQIGGLGPMAGQNHHFNQ
YAPEKIEYAINRYVKETGRLYAVLNKRLADREFVAGDYSIADMAIYPWIAPYERQNQKLE
DFPALQHWFEAIKVRPATIRAYDQAEALKNQALDLEKSRDVLFNQSANTIQR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattgaactttactattgggcaacccccaacggtcataaaatcacgattttcttagaa
gaagcgggactgccttacaagataattccggtaaatatcggtgctggcgaccaatttaag
cccgaatttctgaaaatttctcccaataatcgcatcccggcaatcgtggacaacgaacca
gcaaccggaggtgcgccaatttctgtatttgagtctggggcaatcttgctatatttagcc
gaaaaaaccgggaaattcatcccccaagacttgcctggacgagttgaagtcctccagtgg
ttattttggcaaataggagggttggggccaatggcggggcaaaaccaccactttaaccaa
tacgctcccgaaaaaattgagtatgccattaaccgctatgtgaaggagacaggacgttta
tatgcagtgctgaataaacgactggcagatagagagtttgtagctggcgattattccatt
gcagatatggcaatttatccttggattgcgccttatgagcgccaaaaccaaaagctagaa
gattttccggcgttgcagcactggtttgaggcaattaaagtccgtccggcaacaattcgc
gcctacgatcaggcagaagccttgaaaaatcaggctcttgatctcgaaaagtcgcgagat
gtgttatttaaccaatcggcgaacactatccagcgttga

DBGET integrated database retrieval system