KEGG   Cylindrospermum stagnale: Cylst_2763Help
Entry
Cylst_2763        CDS       T02398                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
csg  Cylindrospermum stagnale
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cylst_2763
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cylst_2763
   00052 Galactose metabolism
    Cylst_2763
   00500 Starch and sucrose metabolism
    Cylst_2763
   00520 Amino sugar and nucleotide sugar metabolism
    Cylst_2763
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cylst_2763
   00524 Butirosin and neomycin biosynthesis
    Cylst_2763
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cylst_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3238174..3239106)
Genome map
AA seq 310 aa AA seqDB search
MLLWFDVLEKELELAIVVEVIGIDLGGTAIKLGRFAPDGSCRQSLTVETPQPATPAAVVA
VMVDAIAQIDPENQTVAIGVGTPGPTDAAGRIAQVAINLAGWQNVPLADYLEAKTGKPTI
LANDANCAGLGEAWLGAGRRFQNLILLTLGTGVGGAIILDGKLFVGHQGAAGELGLITLN
PDGPMCNSGNQGSLEQYASVTAIRRRTGKEPAELGALAQAGDISALTFWQEYGKDLGIGL
SSLIYVLTPQAIIIGGGVSASFEFFLPAVTAEIEKRVIPTSRMGLEILPAELGNSAGMVG
AAKLAWQKVN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgcttttgtggtttgatgttttagagaaagaattggaattggcgatagtggtggaagta
attggcattgatttagggggaacagcgattaagctggggcggtttgcacctgatggcagt
tgccgacaatctttaactgtggaaactccccaacctgcaacaccagcggctgttgtggct
gtgatggtagatgcgatagctcaaattgacccagaaaatcaaactgttgccattggtgtg
gggactccgggtcccaccgatgcagcagggcggattgcccaagtcgccattaacttggca
ggatggcaaaatgtccccttggcagactacttagaagccaaaactggtaaacctaccatt
ctcgctaatgatgctaactgtgccgggttgggagaagcttggttaggtgccggtcgccgc
tttcaaaatctcattttgttgactttgggcactggggttggtggtgcgattattctcgat
ggcaaattgtttgtgggacatcaaggcgctgctggggaattgggtttaatcaccttaaac
cccgatggtccgatgtgtaatagcggtaatcaaggctctctcgaacagtatgcttcagtt
acggcaattcgtcgccgcactggcaaggaaccagcagaattgggcgcccttgcccaagca
ggagacattagtgccttgactttttggcaagaatatggtaaggatttaggtattggcttg
tctagcttaatctacgtcctgacaccacaagcgatcattattggtggcggagtgagtgcc
agttttgaatttttcttaccagcggttacagcagaaattgaaaaacgcgttatacctaca
tctcgcatgggcttagaaattttgccagcagagttgggcaactcagcgggaatggttggt
gctgccaagttggcatggcagaaagttaattag

DBGET integrated database retrieval system