KEGG   Cylindrospermum stagnale: Cylst_2835Help
Entry
Cylst_2835        CDS       T02398                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
csg  Cylindrospermum stagnale
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cylst_2835
Enzymes [BR:csg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cylst_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3308199..3308945
Genome map
AA seq 248 aa AA seqDB search
MAEEKGKVYLVGAGPGDVAYLTVKAYQLLAVAQVLVYDALVDTQLLECVSPDCLKLDVGK
RGGKPSTPQGEINKLLVKYCQQGKQVVRLKSGDPFIFGRCTAEIEALKASGCEFEVIPGI
SSALAAPLLAGIPLTDPVLSRCFAVLTAHEPDVLDWEALSRLETLVILMGGQNLSEIVNQ
LLRYGRSHSTPIAIIRWAGTPSQQIWTGVLGNILEQTASLSLSPVVIVVGEVVGLRHFLQ
PEKMYSED
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaaaaggcaaagtttaccttgtgggtgctgggccaggagatgtagcatat
ctgacagtaaaagcttatcaactcttggctgtcgctcaagtattggtctacgatgcttta
gtagatacccaattattagagtgcgtatcaccagattgcttaaagctagatgtgggtaaa
cgtggtggtaaacccagcactccccaaggtgagattaacaagttactggtgaaatattgc
cagcaaggaaaacaagttgtcaggctgaaatcaggtgatccgtttatttttgggcgctgt
actgccgaaattgaggcattgaaagcatcgggttgtgaatttgaagttataccaggaatt
tcctcagcccttgctgcacctttgctggctggtattcccctcacagatccggttctcagt
cgctgttttgctgtgttaaccgcacacgaaccagatgttttagactgggaagcactatca
cgcttagagacattggtgattttgatgggggggcaaaatctctcagagattgtcaatcaa
ttgttgcgctatgggcgatcgcattctacaccgattgctatcatccgttgggcgggaact
cctagtcaacaaatctggactggcgttctgggtaacattctggaacaaaccgcctcttta
tctctctctccggtggtaattgtggttggtgaagttgtcggtttacgccatttcttacaa
cctgagaaaatgtactctgaagattaa

DBGET integrated database retrieval system