KEGG   Cylindrospermum stagnale: Cylst_3128Help
Entry
Cylst_3128        CDS       T02398                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
csg  Cylindrospermum stagnale
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:csg00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:csg00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3592888..3593976)
Genome map
AA seq 362 aa AA seqDB search
MPALQQLQRFGNHLILGISGTTLSDDDKRALSELKPIGVIFFAKNFLDSTPYQVWLESFK
QLIDQIRQYAERDSMFITLDHEGGRVVRTPLPITRFPYAYLLGTYARQVAQATAVELKSL
GINLSWAPVADIFSHPQNPIIGPRAFGTTPETAAQGAREYFLGLQESSILGCAKHFPGHG
DTSKDSHIELPTLNLTLEDLRNRELIPFKALIEAQVPLIMTAHILFPKIDPDVPATLSQP
ILHHLLREELGFEGVVVSDDLDMKAVSEMFIQPGTVARAFRAGCDLFIVSRNINSSSIER
TYQIAEDFADSLKLGSLDESVVEAARERIEKLLAVTPQYPVYQLDKETLARNAQLAFALG
AA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccagcattgcagcagttacagcgctttgggaaccacctgattctcggtatttctggt
actacattgagtgatgacgataaacgggccctgagtgaactaaagccgattggggtgata
ttcttcgcaaagaactttttggatagcaccccatatcaggtatggctggaaagctttaag
cagttaatcgaccaaatccgccaatatgctgaacgtgactcaatgttcatcactttggat
catgaaggtggaagggtggtgcggacaccgttaccgattacccgcttcccttatgcttat
ttgttgggaacttacgcgcgtcaggtagcacaagccacggctgtagaattaaagtcattg
ggtatcaatctatcttgggcacctgtagccgatattttttcccatccccaaaacccgatc
attgggcctcgcgcctttggtacgactccagaaaccgctgctcaaggtgcccgtgaatac
ttccttggactccaggaatcgagcattttgggatgcgccaagcactttcctggacatgga
gacactagcaaagattctcacattgagttaccaacactcaatctaactttagaagacttg
cgaaatcgggaacttatccccttcaaagcgctaattgaggcgcaagtacctttgattatg
acagcgcatatcttgtttcctaaaatagatcctgatgtgccggcgacactctctcagcct
attttgcatcatctcctccgggaggaactggggtttgaaggtgtggtggtatctgacgat
ttggatatgaaagctgtttctgagatgtttatccaacctgggactgtggcgcgggcattt
cgtgcaggttgtgatttatttatagtatcccgcaatatcaattcatcatcgattgagcgt
acttatcagatagctgaagatttcgctgattctctcaagttaggtagcctcgatgaatcg
gtggtggaagcagctagggaaagaattgagaaattactggcggtaactccgcagtatcca
gtgtatcagcttgacaaggagactttagcgcgaaatgctcaattagcgttcgcccttggc
gcagcgtag

DBGET integrated database retrieval system