KEGG   Cylindrospermum stagnale: Cylst_3230Help
Entry
Cylst_3230        CDS       T02398                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
csg  Cylindrospermum stagnale
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:csg00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:csg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3700586..3702073)
Genome map
AA seq 495 aa AA seqDB search
MNLRELLAAVDGVEELAGLADAEVLGLKTNSHACGVGDLFIGMPGTRVDGGEFWPSALAS
GAVAAIVSQEAIAKNHPTPEAVVISASNMNTACAQIAGAFYGYPGKKLKLVGVTGTNGKT
TTTHLIEFLLTKANLATALMGTLYTRWPGFEQTAVHTTPFAVELQQQLGEAVNAGCKFGV
MEVSSHALAQGRVLGCPFEVGVFSNLTQDHLDYHSDMEDYFAAKALLFSPDYLQGRAIIN
ADDVYGQRLIGSLSRERVWSYSVNDAKADLWMSDLSYQPHGVSGKLHTPKGDVAFRSPLV
GQFNLENLLAAVGAVLHLGLDLELVASVISEFPGVPGRMERVQISETQEISVIVDYAHTP
DSLENLLKAARPFIPGKMICVFGCGGDRDRTKRPLMGKIAAELADVAVVTSDNPRTEDPE
KILQDVLAGIPATIQPTVICERAIAIRTAILQAKPGDGVLLAGKGHEDYQILGTEKIHFD
DREHAREALQARIQG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcgggaattactagcggcggtagatggtgttgaagagttggctggtttggcg
gatgcggaagttttggggttgaagactaattcccatgcctgcggtgtgggtgatttgttt
attggaatgccgggaactagggtagatggtggggagttttggccgagtgctttagcatcg
ggtgcggtagcggccattgtctcgcaggaagcgatcgctaaaaatcatcccacacctgag
gctgttgtcatcagcgctagcaacatgaatacagcttgcgcccagatagcaggggctttt
tacggttatccagggaagaaactcaaattggtgggtgtgacgggtacaaatggcaaaact
accactactcacctgattgaatttctcctcaccaaagctaatctagctacagctttgatg
ggaactctctacactcgttggcctggttttgaacaaactgctgtccacacgacaccgttt
gctgtggaactgcaacaacagctaggagaagctgtaaatgctggttgtaagtttggggtg
atggaagttagttcccacgctttagcccaaggtcgggtgttgggttgtccttttgaggtg
ggggtgtttagcaatctcacccaagaccatctcgactatcacagcgatatggaagattat
tttgccgctaaagcgttgttgtttagccctgattatctccaaggacgggcgataattaat
gctgatgacgtttacggtcagcggttaattgggtcgttgagtcgagaacgggtttggagt
tacagtgtcaacgatgccaaagctgacttgtggatgagtgacttgagttatcagcctcat
ggtgtcagcggtaaactgcatacaccaaagggtgatgtggcttttcgttcacctttggtt
ggtcaatttaatttagagaatcttttggcagcggtgggcgcagttttacatttagggcta
gatttggagttagtagcctctgtgatttctgagtttcccggcgttcctggaaggatggaa
cgggtgcagattagtgaaacgcaagaaatcagcgtgattgtggattatgctcacacaccg
gatagtttggaaaatttgctcaaagctgcacgtccgtttattcctgggaagatgatttgc
gtgtttggttgcggaggcgatcgcgatcgcaccaagcgcccactcatgggaaagatcgcc
gccgaattagcagatgtggcagtggtgacatcagataatccccgcaccgaagacccagaa
aaaatcttgcaagatgtcttagccgggattcccgcaactatacagccgacggtaatttgc
gagcgcgcgatcgccattcgcaccgccattctacaagctaaacccggcgatggggtattg
ttggctggtaaaggtcatgaagactaccaaattctcggcaccgaaaaaatccattttgac
gaccgagaacatgcacgggaggctttacaagcaagaattcaaggttaa

DBGET integrated database retrieval system