KEGG   Cylindrospermum stagnale: Cylst_3339Help
Entry
Cylst_3339        CDS       T02398                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
csg  Cylindrospermum stagnale
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cylst_3339
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cylst_3339
  Lipid metabolism
   00071 Fatty acid degradation
    Cylst_3339
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cylst_3339
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cylst_3339
   00626 Naphthalene degradation
    Cylst_3339
Enzymes [BR:csg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cylst_3339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3817739..3818719
Genome map
AA seq 326 aa AA seqDB search
MLEAPRQPLRLADLPVPKPNPEQVLIRVHACAVCRTDLHIVDGELTQPKLPLVPGHQIVG
TIEMIGSHVNKFSIGQRVGVPWLGHTCDRCRYCLSGRENLCDRAEFTGYNLDGGYAEYTV
ADHRFCFPLDPSYSDLQAAPLLCGGLIGYRAYRMTGDPEKIGFYGFGSAAHILIQLARYQ
SRHVYAFTRDGDVKGQEFARQLGATWAGDSSILPPEPLDAAIIFAPVGRLVPAALRAVAK
GGIVICAGIHMSDIPSFPYNILWEEKILRSVANLTRKDGEEFLALAPKVPIRTEVNPFPL
TQANEALDALRSGKIEGSAVLVVASA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttagaggcaccgcgtcagcctttgcggctagctgatttaccagtgccaaaacccaat
ccagagcaagtactgattcgcgttcatgcttgtgctgtctgccgcacagatttacatata
gttgatggggaattgacgcaaccgaaattacctttagtgcctggacatcaaattgtgggt
actattgaaatgatcggcagtcatgttaataaatttagtattggtcaacgtgttggcgtt
ccctggctaggtcatacatgcgatcgctgtcgttattgtctgtctggacgtgaaaacttg
tgcgatcgcgccgagttcacaggttacaatcttgatggcggctatgcagaatacactgta
gccgaccaccgtttttgttttcccctagatcctagctattctgacttgcaagctgcaccc
ctactatgtggtggcttaattggctatcgcgcttacagaatgactggtgatcccgaaaaa
atcggtttttatggctttggttcagctgcccatattctaattcaactggcgcgttatcaa
agtcgtcacgtatacgcttttacccgtgatggcgatgttaaagggcaagaatttgctcgt
caattgggtgcaacttgggctggtgactctagcatattacccccagaacccttagatgca
gcgattatatttgcgccagtcgggagactcgtacctgcggctttgcgtgcagttgctaaa
ggcggtatagtaatttgtgcaggcattcacatgagtgatataccgagttttccctataat
attctttgggaagaaaaaatcttgcggtctgtagctaacttgacgcgcaaagatggagaa
gagtttctcgccttagcgcccaaagttcccatccgcacagaagtaaatcccttcccctta
actcaagcgaacgaggcactagatgccctgcgtagtggcaaaattgagggatcagccgtg
ttggtggtagctagcgcctaa

DBGET integrated database retrieval system