KEGG   Cylindrospermum stagnale: Cylst_4041Help
Entry
Cylst_4041        CDS       T02398                                 

Definition
cobaltochelatase CobN subunit (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
csg  Cylindrospermum stagnale
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cylst_4041
Enzymes [BR:csg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cylst_4041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4588403..4592143)
Genome map
AA seq 1246 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAFVANSRCPELDIRVFSDRDITTKGIEVEASLQGADVFF
GSLLFDYDQVMWLRQRLQRVPIRLVFESALELMSLTKLGDFAIGDKPKGMPKPVKFILDK
FSNGREEDKLAGYISFLKIGPKLLKFVPVQKVQDLRNWLIIYGYWNAGGPENVASLFWTL
AEKYLKLKIGDIPPPLETPNMGLLHPDYQGFFTSPREYLEWYQKKIRTSPPFQEGLGGSP
SIKPVVGILLYRKHVITKLPYIPQLISQFETAGLIPLPIFINGVEGHVAVRDWMTTDYEI
QQRQLGNIQTPSLSNEAVKIDAIVSTIGFPLVGGPAGSMEAGRQIEVAKRILTAKNIPYI
IAAPLLIQDIYSWTRQGVGGLQSVVLYALPELDGAIDTIPLGGLVGEQIYLVPERVQRLI
GRVKSWVSLRQKPVSERKISIILYGFPPGYGAVGTAALLNVPRSLIKFLHALKDQGYTVG
DIPDDGEELIRRVKAADENPTPTLPASGEGVISPLVYGGVRGGSSVNARTLEKWLGYLRT
SRIEKQWKSLTGTGIKTYGDEFNIGGVQLGNIWIGVQPPLGIQGDPMRLMFERDLTPHPQ
YAAFYKWLQNDFQADAVVHFGMHGTVEWLPGSPLGNTGYSWSDILLGNLPNLYIYAANNP
SESILAKRRGYGVLISHNVPPYGRAGLYKELVALRDLIAEYREDPQKNYLLKEGICKKIV
DTGLDADCPFEDAKRLGITFSPENVRLFSGHAFDDYLVKLYEYLQVLECRLFSSGLHVLG
EAPNEEEMAGYLNGYFGEDNEPPRCQERQEEEGEIRDLLMQSTDELTNLLRGLNGEFILP
APGGDLLRDGAGVLPTGRNIHALDPYRMPSPAAFERGREIGRKMISQHLDEHGKYPETVA
VLLWGLDAIKTKGESLGILLELVGAEPVKEGTGRIVRYELKSLGDVGHPRIDVLGNLSGI
FRDSFVNIIELLDDLFQRAADADESEEENFIRKHALALKAQGVENTSARLFSNPAGDFGS
LVNDRVVDGNWESGEELGNTWQSRNVFSYGREDKGQARPEVLQTLLKTSDRIIQEIDSVE
YGLTDIQEYYANTGGLKKAAEKQSGKKVTTSFVESFSKDTTPRNLDDLLRMEYRTKLLNP
KWADAMANQGSGGAFEISQRMTALIGWGGTADFTDDWVYDQAADTYALDADMAEKLRKAN
PEAFRNIIGRMLEAHGRGFWQTDQDKLDKLRQLYDLTDEQLEGVTV
NT seq 3741 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatcgtcttgattgctgggtttgaatcgttcaacgctgacttgtacaggaaa
gcggcttttgtggctaactctcgctgtccggagttggatattcgggtgtttagcgatcgc
gatattaccaccaagggaatcgaggtagaagcatcactccaaggcgcagatgtgttcttc
ggcagcttgctgtttgactatgatcaagtgatgtggttgcgtcagcgccttcaaagagtc
cccatccgtctcgtcttcgagtcagccttagaattgatgagtttaaccaaactgggtgat
tttgcgatcggtgacaaacccaaaggaatgcccaaaccagttaaattcatcctcgacaaa
tttagcaacggaagagaagaagacaaactcgccggttatatcagcttcttaaaaatcggc
cccaaactcctcaaattcgtcccagtacaaaaagtccaagacttacgtaactggttaatt
atctatggctactggaatgcaggcggtccagaaaacgtcgcctcattattctggacacta
gcagaaaaatacctaaaattaaaaatcggcgacattccaccaccactagaaacccccaac
atgggattactccatcccgactatcaagggttttttacatccccccgcgaatatttagaa
tggtaccaaaagaagatcagaactagcccccctttccaagaggggttggggggatctcca
tcaataaaacccgtagtcggtattcttctttatcgcaaacacgttattaccaaactaccc
tacattccccaactaattagccaatttgaaacagccggattaatccccttacccatcttt
atcaacggcgtagaaggacacgttgcagtccgcgattggatgacaaccgactacgaaatt
caacaacgacaactaggtaatattcaaactccctcactttctaatgaagcagttaaaata
gatgcaatcgtttccacaatcggctttcctttagtcggtggacccgcaggttcaatggaa
gcagggcggcaaatagaagtcgccaaacgcattcttaccgctaaaaatataccctacatt
atcgccgcacccctgctaattcaagatatctactcatggacacgccaaggtgtcggcgga
ctgcaaagtgtagtcttgtatgccttaccagaactagacggggcaattgatactatcccc
ctcggcggtttagttggtgaacaaatttatttagttcctgaacgagtacaaagattaatt
ggtagagtcaaaagctgggtttctttgcggcaaaaacctgtatcagaacgcaaaatttcg
attattttatatgggtttccccctggttatggcgctgtaggtactgctgcattattaaat
gttccccgcagtttaataaaatttcttcatgcactcaaagaccaaggttataccgtcggc
gatattcctgatgatggcgaagaattaattcgccgtgtgaaagcagcagatgagaacccc
accccaaccctccccgcaagcggagagggagtcatatcccccctcgtttacgggggggtt
agggggggttcttctgtgaatgcgcgtactctagaaaaatggttaggatatctccgcact
tctcgcatcgaaaaacaatggaaatctctcacgggaacgggtattaaaacttatggtgat
gaatttaatattggcggtgtgcagttaggaaatatctggataggtgtacaaccacctttg
ggaattcaaggcgaccctatgcgcttaatgtttgaaagagatttaacccctcatccccaa
tatgctgctttttataaatggctacaaaatgattttcaagctgatgctgtagttcacttt
ggtatgcacggaactgtggaatggttgccgggttcaccgttgggtaatactggttattct
tggtctgatattttgttaggaaatttgcctaatctctatatatatgcggcgaataatcct
tctgaatctattttggcaaagcgtcgcggttatggggtgttaatttctcacaatgtacca
ccttatggtcgtgcaggtttatataaggagttggtggctttaagggatttaattgctgaa
tatcgcgaagatccgcaaaagaattatctgctgaaggaagggatttgtaagaagattgtt
gatactggtttagatgctgattgtccttttgaagatgctaaacggttggggattactttt
agtccggaaaatgtgcggttgtttagtggtcatgcttttgatgattatctggtgaagttg
tatgagtatctgcaagttctagaatgtcggctgttttcttctgggttgcatgttttgggt
gaagcgccgaatgaggaggaaatggcggggtatttgaatggttattttggggaggataac
gaaccgccaagatgccaagaacgccaagaggaggaaggagaaattagggatttgttgatg
caatctactgatgagttaacaaatcttttgcggggtttgaatggggagtttattcttcct
gcgcctggtggtgatttgttgcgtgatggggctggggttttgcctacggggcggaatatt
catgctttagatccttatcgaatgccttcgcctgcggcttttgaaagaggtagggaaatt
ggccgaaagatgatctctcagcatttagatgaacatgggaaatatccggaaactgtggcg
gttttgttatggggtttggatgcgattaaaactaagggtgaatctctaggtattcttttg
gaattggtgggggctgaacctgttaaggaggggactggcagaattgttagatatgagttg
aaatctcttggagatgtgggacatcctcgaatcgatgtgttggggaatctatcgggaatt
tttcgggatagttttgtgaatattatcgagttgttggatgatttgtttcaacgggctgct
gatgctgatgagtcggaggaagagaattttattagaaaacacgctttggctttgaaggcg
caaggggttgagaatacgtcggcgcggttgttttctaatcctgcgggtgattttggttct
ttggtgaatgacagggttgtggatggtaactgggagtctggggaggagttggggaatact
tggcaaagtcgcaatgtttttagctatggtagggaagataagggtcaggctagaccggaa
gttttgcagacattgctgaaaactagcgatcgcattatccaagaaatcgactcggtagaa
tatgggttaactgatattcaggaatactacgccaacactggcggtttgaagaaagcagcc
gaaaagcaaagcggtaaaaaggtaacaactagctttgtcgaaagtttctctaaggacacc
acaccccgaaatttagatgatttgctgcggatggaataccgcactaagttactaaatccc
aaatgggccgatgcaatggctaatcaaggttctggtggtgcttttgaaatttcccaacgg
atgacggcattaatcggttggggtggtactgcggattttactgatgattgggtatatgac
caagccgctgatacctatgctttagacgcagacatggcggagaagttacgcaaagctaat
cctgaagctttccgaaatatcatcggcagaatgttagaagcacatggacgcggtttctgg
caaactgatcaagataagttagataaattgcgccagttgtatgatttgactgatgaacaa
ttggaaggagtgacggtgtaa

DBGET integrated database retrieval system