KEGG   Cylindrospermum stagnale: Cylst_4048Help
Entry
Cylst_4048        CDS       T02398                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
csg  Cylindrospermum stagnale
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cylst_4048
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cylst_4048
Exosome [BR:csg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cylst_4048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4597483..4598976)
Genome map
AA seq 497 aa AA seqDB search
MTKYVAAIDQGTTSTRFIIFDKQGKIVGYAQKEHQQIYPQPGWVEHDPEEIWSCTQTVIK
DALEQSNISVAEITAVGITNQRETIVVWDQKTGKPYYNAIVWQDTRTNHICNQLAEDGGI
DHFRATTGLPLATYFSAPKIKWLLANVPGLKAAAENGNAFFGTIDTFLIWHLTGGTQGGL
HITDVTNASRTLLMNLNTLDWEPEILEIMGIPRQMLPEICPSSAIYGKATGILAGVPIAA
DLGDQQAALIGQTCFQVGETKNTYGTGCFMLLNTGQQQVISQHGLLTTVAYKLGDAPAVY
ALEGSIAIAGALVQWLRDNLGLIQSSAEVEALASTVTDNGGVYFVPAFSGLFAPYWRSDA
RGAMVGMTRYTNKGHIARAVLEATAWQTREVLDAMREDAQINLTALKVDGGMVYNNLLMQ
FQSDVLGVPVIRPQVAETTALGAAYAAGLATGFWGSLEELSDNWLLDQTWQPKMDAVQRE
SYYTLWKKAVTKTFDWI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatacgtagctgcaattgaccaaggaacgaccagtactcgcttcatcatcttt
gataagcagggtaaaatagttggctatgcacaaaaagaacatcagcagatttatcctcaa
cctggttgggtagaacacgaccccgaagaaatttggtcatgcactcaaactgtgattaaa
gatgccttagagcagagtaatatttcggttgctgagattacagccgttggcattactaat
cagcgcgaaacaatagtagtttgggatcagaaaacaggcaaaccttactacaatgccatt
gtctggcaagataccagaacgaaccacatctgtaatcaactagcagaagatggtggtata
gaccattttcgcgccacaactggtttaccacttgctacttacttcagcgcacccaaaatt
aagtggttattggcaaacgtaccaggattaaaagccgcagctgaaaatggtaacgcgttt
tttggcacaattgacacctttttgatttggcatttaacaggtggtacacaaggcggtttg
cacattactgatgttaccaatgccagtcgtaccttgctgatgaacttgaatactctggac
tgggaaccggaaattttggagattatgggtattccccggcaaatgctgccggaaatttgc
ccttcatcagccatctatggcaaggctacaggcattcttgcaggagttcccattgctgct
gacttaggtgatcaacaagctgcattgattggacaaacttgttttcaggtaggtgaaacc
aaaaatacctatggtacaggttgctttatgctgctgaatacaggccagcaacaagtgatt
tcccaacatggtttactgacaaccgtagcttacaagttgggtgatgctccggccgtttat
gccttggagggtagtattgcgatcgcaggtgctctagtccaatggttgcgtgacaatttg
ggactgattcaaagcagtgcagaagtagaagcattagccagcacagttacagataacggt
ggcgtttattttgtccctgctttctctgggttgtttgctccttattggcgcagtgatgct
agaggtgcaatggtgggtatgacccgctacacaaataaaggtcatattgcccgtgccgtg
ttagaagcaacagcatggcagactcgtgaagttttagatgccatgagagaagatgcacag
ataaatttaactgctttgaaggtagatggtgggatggtttacaacaacctgctgatgcaa
tttcaaagcgatgtgctaggtgtgccagtgattcgtccccaagtagcggagactacagct
ttaggggcagcttatgctgctgggttggcaacaggtttctggggtagtctggaggaatta
tctgataattggcttttagaccagacttggcaaccgaaaatggatgctgtacagagagaa
agctattatactctttggaagaaagctgttactaaaacctttgattggatatag

DBGET integrated database retrieval system