KEGG   Cylindrospermum stagnale: Cylst_4048Help
Entry
Cylst_4048        CDS       T02398                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
csg  Cylindrospermum stagnale
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:csg00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4597483..4598976)
Genome map
AA seq 497 aa AA seqDB search
MTKYVAAIDQGTTSTRFIIFDKQGKIVGYAQKEHQQIYPQPGWVEHDPEEIWSCTQTVIK
DALEQSNISVAEITAVGITNQRETIVVWDQKTGKPYYNAIVWQDTRTNHICNQLAEDGGI
DHFRATTGLPLATYFSAPKIKWLLANVPGLKAAAENGNAFFGTIDTFLIWHLTGGTQGGL
HITDVTNASRTLLMNLNTLDWEPEILEIMGIPRQMLPEICPSSAIYGKATGILAGVPIAA
DLGDQQAALIGQTCFQVGETKNTYGTGCFMLLNTGQQQVISQHGLLTTVAYKLGDAPAVY
ALEGSIAIAGALVQWLRDNLGLIQSSAEVEALASTVTDNGGVYFVPAFSGLFAPYWRSDA
RGAMVGMTRYTNKGHIARAVLEATAWQTREVLDAMREDAQINLTALKVDGGMVYNNLLMQ
FQSDVLGVPVIRPQVAETTALGAAYAAGLATGFWGSLEELSDNWLLDQTWQPKMDAVQRE
SYYTLWKKAVTKTFDWI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatacgtagctgcaattgaccaaggaacgaccagtactcgcttcatcatcttt
gataagcagggtaaaatagttggctatgcacaaaaagaacatcagcagatttatcctcaa
cctggttgggtagaacacgaccccgaagaaatttggtcatgcactcaaactgtgattaaa
gatgccttagagcagagtaatatttcggttgctgagattacagccgttggcattactaat
cagcgcgaaacaatagtagtttgggatcagaaaacaggcaaaccttactacaatgccatt
gtctggcaagataccagaacgaaccacatctgtaatcaactagcagaagatggtggtata
gaccattttcgcgccacaactggtttaccacttgctacttacttcagcgcacccaaaatt
aagtggttattggcaaacgtaccaggattaaaagccgcagctgaaaatggtaacgcgttt
tttggcacaattgacacctttttgatttggcatttaacaggtggtacacaaggcggtttg
cacattactgatgttaccaatgccagtcgtaccttgctgatgaacttgaatactctggac
tgggaaccggaaattttggagattatgggtattccccggcaaatgctgccggaaatttgc
ccttcatcagccatctatggcaaggctacaggcattcttgcaggagttcccattgctgct
gacttaggtgatcaacaagctgcattgattggacaaacttgttttcaggtaggtgaaacc
aaaaatacctatggtacaggttgctttatgctgctgaatacaggccagcaacaagtgatt
tcccaacatggtttactgacaaccgtagcttacaagttgggtgatgctccggccgtttat
gccttggagggtagtattgcgatcgcaggtgctctagtccaatggttgcgtgacaatttg
ggactgattcaaagcagtgcagaagtagaagcattagccagcacagttacagataacggt
ggcgtttattttgtccctgctttctctgggttgtttgctccttattggcgcagtgatgct
agaggtgcaatggtgggtatgacccgctacacaaataaaggtcatattgcccgtgccgtg
ttagaagcaacagcatggcagactcgtgaagttttagatgccatgagagaagatgcacag
ataaatttaactgctttgaaggtagatggtgggatggtttacaacaacctgctgatgcaa
tttcaaagcgatgtgctaggtgtgccagtgattcgtccccaagtagcggagactacagct
ttaggggcagcttatgctgctgggttggcaacaggtttctggggtagtctggaggaatta
tctgataattggcttttagaccagacttggcaaccgaaaatggatgctgtacagagagaa
agctattatactctttggaagaaagctgttactaaaacctttgattggatatag

DBGET integrated database retrieval system