KEGG   Cylindrospermum stagnale: Cylst_4795Help
Entry
Cylst_4795        CDS       T02398                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csg  Cylindrospermum stagnale
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cylst_4795
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cylst_4795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5437225..5438166
Genome map
AA seq 313 aa AA seqDB search
MTIIVFGSINIDLVATAKSLPVAGETLLGESFLKVPGGKGANQAVALARLGIPTQIVGRV
GADSFGEELVSNLQASGVQTDNILVDESVSSGVAIINVDHHGENQIVVVPGANGRVNQED
VERLSRLLPTATAILLQLEIPMAAVVAAAQAARNANITVILDPAPARSHLPEELYPLVDI
ITPNEVEAGQLVGFAVDGEETAAQATAILLQRGVKCAIAKLGAKGVYCATAEESFFLRAF
PVQAVDTVAAGDAFNGGLAAALTAGLSLHQAVVWGAAAGALATTKQGAQTSLPDKSTFDA
FLRQKGLQQFSSI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacaataatcgtctttggtagtatcaatatagatttagtcgccacagccaagagctta
ccagttgccggcgaaaccctattaggagaaagttttttgaaagtaccgggagggaaaggt
gcaaatcaagcggtagcattagcgcggttgggaattcctactcaaattgtcggacgtgtt
ggtgcagatagttttggtgaagaactggttagcaatttgcaagcatcgggtgtacaaact
gataatatcttagttgatgaaagcgtgagttctggagttgctatcatcaacgtagatcat
catggtgaaaatcaaatcgttgttgttcccggtgcaaatgggagagttaatcaagaagat
gtagaacgattatctcggttattaccaacagcgacagcaatacttttacagctagaaatt
ccgatggcggcggtggtggcagctgcccaagcggcacgtaatgccaatataacagtaatt
ctcgacccagcaccggcgcgatcgcatttaccagaggaactttacccgttagtggatatt
atcacaccaaatgaggttgaggcggggcagttggtgggttttgcggtggatggggaagaa
acagcagctcaggctactgcgattttattacaaaggggggtgaaatgcgcgatcgctaaa
ttgggtgcaaaaggcgtttactgtgccaccgctgaagaaagtttttttctaagagcgttc
ccagttcaagccgttgacacagtcgccgctggtgatgcttttaacggtggtttagcagca
gcacttaccgccggactttctttacatcaggcggttgtttggggtgcagcagcgggtgct
ttagcaacaacaaaacaaggcgcacaaacttcgctacccgacaagtctacctttgatgcc
tttcttcggcaaaaaggattacagcagttttcatctatttga

DBGET integrated database retrieval system