KEGG   Cylindrospermum stagnale: Cylst_5111Help
Entry
Cylst_5111        CDS       T02398                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csg  Cylindrospermum stagnale
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cylst_5111
Enzymes [BR:csg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cylst_5111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5800500..5802008
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPSSFPSRFGIGDLGLEAYSFIDFLKESYQQYWQVLPLGPTGYGNSPYM
CYSAMAGNPLLISPEKLLDEGLLAEEDFAHLPGFWADKVDFEQVVPIKINLLKKASEKFK
TQATPIQQKQFEGFCDSKAYWLDNYALFMALKDAHNGASWHTWKPELAKRKPAALDLAQQ
QLSDQIFYYKFVQYEFFRQWSALKSYANMRGIEIIGDIPIYVAHDSADVWANPDIFCLDE
ETGEAAQMAGVPPDYFSATGQLWGNPVYNWEKLQKQDFKWWVQRFEAMLDYVDIIRIDHF
RGFEAYWSVPQGEETAMNGEWIEAPGDAFFEVIKQKLGKLPILAEDLGVITPEVEALRDK
FEFPGMKVLQFAFGSDPGNPFLPFNYSRNAVVYTGTHDNDTTVGWYNTASDWEKRNLWLY
LGCISPQGINWDLIRLALSSIANQAIIPLQDVLGLGNEARMNFPGTAVGNWGWRYQAAVL
TEELGDRLKVLTTLCGRAPRQS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccctttccccgatccagtggcattctgctacatccaagctcctttcccagtcgattt
ggcattggtgatttaggtttagaagcttatagttttattgattttcttaaggaaagttac
cagcaatattggcaagttttacccttaggccccactgggtacggaaattcgccttatatg
tgctactcagcaatggcaggaaatcccctgttgattagcccagaaaaactgctagatgaa
ggtttactagctgaagaagactttgctcatttgcctggattttgggcagataaagtagat
tttgagcaagtggtaccaattaagattaatctgctaaaaaaagctagcgagaagtttaaa
actcaggcgacacctattcagcagaaacagtttgagggtttttgtgatagcaaagcctat
tggctagataattatgccttgtttatggcgcttaaagatgcccacaacggtgctagctgg
catacatggaagccagaactggccaagcgcaaaccagcggcattagatttggcacaacaa
cagctatcagaccagattttttattacaagttcgtccagtatgagtttttccgccagtgg
tcagcacttaagagctatgccaatatgcgcggtatagaaattattggcgatatacctatt
tacgtagctcatgatagcgctgatgtttgggccaatcccgatattttttgtctagatgaa
gagacgggagaagctgcccaaatggcgggtgtgccaccagattactttagcgccaccggt
caattgtggggcaacccggtttataactgggagaaattgcaaaaacaagactttaaatgg
tgggtgcaacgctttgaagcgatgctggattatgtagatattattcgcattgaccacttc
cggggatttgaggcttattggtctgtaccccaaggggaagaaacggcgatgaatggcgaa
tggattgaagcacctggggatgctttttttgaagttattaaacagaaattgggcaaacta
ccgattttggcggaagatttaggggtgattacccctgaggtagaagcgctgcgagataag
tttgaatttccggggatgaaagttttgcagtttgcttttggttctgatcccggtaatcca
tttttacccttcaactactcgcgcaatgctgtagtttatactggcactcacgataatgac
accaccgtgggctggtacaacacagcgagtgattgggaaaagcgaaatttatggctttat
ttgggttgtatcagtcctcaaggcatcaactgggatttaattcgactagcgttgagttct
atagccaatcaggcaattattcctttacaagatgtgttgggattagggaacgaagcgcga
atgaattttcccggtaccgctgtggggaactggggctggcgctatcaagcggcagttttg
accgaggaattaggcgatcgcttaaaagttctcaccaccctctgtggacgcgcccctaga
cagtcctga

DBGET integrated database retrieval system