KEGG   Cylindrospermum stagnale: Cylst_5355Help
Entry
Cylst_5355        CDS       T02398                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
csg  Cylindrospermum stagnale
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cylst_5355
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cylst_5355
Enzymes [BR:csg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cylst_5355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6050064..6052514)
Genome map
AA seq 816 aa AA seqDB search
MTILPSPEIPACTWNRPIGLGWDKPYTVRYPSNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHTFKNIPACQFSVFESHGASSQAYALSTEPPEDGTLSAWQWYPRSAESKAG
KMPTPQDTGTYHALYPRSWFVYENVFQAQLSCEQFSPVWANNYQETSYPVAVFNWKAHNP
TDAPITLSIMLTWENMVGWFTNALKSPKVQIRDDGSPVYEYQPRLGKSQGNYHQLIENTQ
QVGCVLGRVASDAPVQEGDGTWCIATRKHPLIEVFHHTRWNPVGTGDEVWQSFAADGSLP
NYVDETAAAENTRIGAALAVRFTLQPGECLEVPFVLAWDFPVTEFAAGVNYYRRYTDFFG
RSGQNAEAIAFLSLQEYQNWRSQIQNWQKPILVREDLPPWFKMALFNELYDLTSGGTLWS
AASELDPFGQFAVLECLDYRWYESLDVRLYGSFALLMLFPELEKSVIRAFARAIPQSDDH
QRIIGYYYTIGADTTTAVRKIAGATPHDLGAPNEHVWEKTNYTCYQDCNLWKDLGSDFVL
QVYRDFLFTGADDVEFLADCWDAIVQTLDYLKGFDKDGDGIPENSGAPDQTFDDWRLQGV
SAYCGGLWLAALECAIAICDILLTNRQDAKNAKNLETQRSIYGAWLAQSLTVYEEKLWNG
QYYRLDSESGTEVVMADQLCGQFYARLLGLPDIVKCDRALSALQTVYDACFLKFFDGQFG
AANGVRPDGVPENPNATHPLEVWTGINFGLAAFLVQMGMQDEALRLTQAVVSQIYDNGLQ
FRTPEAITTTGTFRASTYLRPMAIWAIYLVQNLSKS
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgactattttaccctccccggaaattcccgcttgcacttggaaccgtcccattggactc
ggctgggacaaaccctatacagtccgctaccctagcaatattgatgatggcccgtggcat
gggatgcctttaggtggctttggtgctggttgcattggtcgttcttcacggggagacttt
aacctgtggcatattgacggcggtgaacatactttcaaaaatatccctgcttgtcaattt
agcgtttttgagtctcatggcgcctcctctcaggcttacgctttatctaccgaacccccg
gaagatggcactctctctgcttggcaatggtatccgcgtagtgcagaatcaaaggcgggc
aagatgcccaccccacaagatacaggcacatatcacgctttgtatccgcgtagttggttt
gtttatgagaatgtatttcaagcacagttaagctgtgagcaattttccccggtttgggcg
aataattaccaagaaactagctaccctgtggcggtgtttaactggaaagcacataacccg
acagatgcacctatcactctcagtattatgctcacttgggaaaatatggtaggttggttt
actaatgccctgaaatctcccaaagtgcagatacgggatgatggtagtccggtttatgaa
tatcagccacggttgggaaaaagtcaaggaaattatcatcagttaattgaaaatactcaa
caagttggttgtgttttaggtcgggtggctagtgatgcacctgtgcaggaaggggacggg
acttggtgtattgcaactcgcaaacatcccctgattgaggtatttcaccacactcgatgg
aatcctgttggtacgggtgatgaggtgtggcaaagctttgctgctgatggttctttgcct
aattatgtagatgagacagcggccgcagagaatacccgaattggggcggcgctggctgtg
cgtttcactctgcaacctggggaatgtttagaagttccttttgtgctggcttgggatttt
ccggtgacggaatttgcggcgggagttaactattatcgcagatatacagacttttttggg
cgcagtggtcaaaatgctgaggcgatcgcatttctatctctacaagaataccaaaattgg
cgatcgcagattcaaaactggcaaaaaccgattcttgtccgcgaagatttacctccctgg
ttcaaaatggctctatttaatgagctttacgaccttaccagcggcgggactctctggagt
gcagcctcagaacttgaccccttcggtcagtttgcagtattagaatgcttagattaccgc
tggtatgaaagtctcgatgtgcggttatacggttccttcgctttgctgatgttatttccc
gaattggaaaagtcggtaattcgggcttttgcacgggcaattccccagagtgatgatcat
cagcggattattggctactattacaccattggggcagatactaccacagcagtccgcaaa
attgccggggcgacaccccatgatttgggcgcacccaatgaacacgtctgggaaaaaact
aactatacctgctatcaagattgcaatttgtggaaggatttgggcagtgattttgtgttg
caagtataccgagattttctgtttacgggtgctgatgatgtggaatttctcgcagattgt
tgggatgcgattgtgcagactcttgattatttgaaaggtttcgacaaagatggggatggg
attccggaaaattctggcgcacctgaccaaacttttgatgattggcggttgcagggtgtg
agtgcttattgtggggggttgtggttggcggctttggaatgtgcgatcgctatttgtgat
attttattaacgaaccgccaagacgccaagaacgccaagaatttggagacgcaaaggtct
atttatggggcttggttggcgcaatctctgactgtgtatgaggagaagctttggaatggc
caatattaccgtctggatagtgaaagtggaactgaagtggtaatggcagatcagttgtgt
gggcagttctacgctagattgttgggattaccagatattgtaaaatgcgatcgcgctctc
tctgctttacaaacagtatatgatgcttgtttcttaaaattcttcgatggtcagtttggt
gctgctaacggtgtgcgtcccgatggtgtcccggaaaatcctaatgctactcatccccta
gaagtctggacggggattaactttggactggcagcttttctcgtgcaaatgggaatgcag
gatgaagcattgcggttaacacaagctgtggtaagccaaatttacgacaatgggttgcaa
ttccgcactcctgaagccatcaccaccactggtactttccgcgctagtacttacctgcgg
ccaatggctatttgggcaatttacttggttcagaacttatccaagtcctag

DBGET integrated database retrieval system