KEGG   Cylindrospermum stagnale: Cylst_5513Help
Entry
Cylst_5513        CDS       T02398                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00010  Glycolysis / Gluconeogenesis
csg00052  Galactose metabolism
csg00500  Starch and sucrose metabolism
csg00520  Amino sugar and nucleotide sugar metabolism
csg00521  Streptomycin biosynthesis
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
csg01120  Microbial metabolism in diverse environments
csg01130  Biosynthesis of antibiotics
csg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cylst_5513
   00052 Galactose metabolism
    Cylst_5513
   00500 Starch and sucrose metabolism
    Cylst_5513
   00520 Amino sugar and nucleotide sugar metabolism
    Cylst_5513
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cylst_5513
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cylst_5513
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cylst_5513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFZ27524
UniProt: K9X604
Position
6189254..6190258
Genome map
AA seq 334 aa AA seqDB search
MPKAPVPIFIIVMAFILALDFGGTKLAAATVNVGSREWLRYESRLSPANADVLSDLDIMR
SLIDSLLKGSKPDAIGVSFGGPVDAATGLVRLSHHVPGWENIPLKDLLEEEYRVPVTVDN
DANVAALGEHRFGAGQGYESLFYITISTGVGGGWILNGKPWRGASGMAGEIGHMVVDPHG
PVCLCGKRGCVERLASGPYMAQNAREILAAESLSRKGIVRGEILRNLVGDNLSLLTGQLV
SQAAAEGDNLAQEVLQKAAWALGVGIGNVANLMNPQRFVLGGGVTKAGEAFWQVVRRVAR
ETALPEVNFEIVRAVLGDDAPLWGAVALGLEVLH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggccccagtccctatttttataatagttatggcatttatattagctcttgat
tttggcggaactaaactggcggcggcgacggtaaatgtcggttctagggagtggctacgt
tatgaaagtcgtctctcaccggcgaatgcagatgtgctgagtgatttagatataatgcga
tcgctaattgattctctactcaaaggctcaaaacccgatgccattggtgttagttttggc
ggcccagtagacgcagccacaggtttagtgcgactctctcaccatgtccccggctgggaa
aacatacccctgaaagacttgctagaagaagaatatcgcgtgcctgtgactgtagacaac
gatgccaatgtagcggctttaggcgaacatcgctttggtgctgggcagggatacgaaagc
ctgttttacatcaccatcagcaccggcgtgggtggtggttggatactcaatggcaaacct
tggcggggtgcatcagggatggctggggaaattggacatatggttgtcgatcctcatggg
ccagtatgtctgtgtggtaagcgcggttgtgtggaacgtttagcatctggcccctacatg
gcccaaaatgccagagaaattttagcagctgaatctctgagtcgaaaaggcatcgtcagg
ggagagatattgaggaatttagtaggggataatttaagcctacttacggggcaattagtc
agtcaagcggcagcagagggagataatttagctcaggaagttttgcaaaaggcagcttgg
gcgctaggtgtgggtattggcaatgtcgcaaacttgatgaacccccagcgctttgttttg
ggtggtggtgtgacaaaagcgggagaggctttttggcaagtggtgcgaagagtagcgcga
gagacagcgttaccagaagttaattttgaaattgtccgtgcggtgctgggtgatgatgca
ccgttgtggggtgctgtggctttgggtttagaagttttgcattga

DBGET integrated database retrieval system