KEGG   Cylindrospermum stagnale: Cylst_5523Help
Entry
Cylst_5523        CDS       T02398                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
csg  Cylindrospermum stagnale
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6201286..6202653
Genome map
AA seq 455 aa AA seqDB search
MINKVALNLIKLSIITLFIVINLGSNSYALEIQNFDKSSGINSFLNYQVKQIIKAAAPGN
KGLDYFILPESSELDKIPSEPQNPITSAKVELGKALFHETALSINPLNPKHWQQSSCATC
HIAQAGFRANIAQGLGTGGLGWNQFRHRDPEISPVQIDKQNVLVPSVLNSAYQTVQMWDG
RIGVAGPNIKEAIIKNNDVNRHQLQGLETQPIDGIAFHRLGTAAIAQIPEYQKMFAAAFP
DRPYVSAEQEDNKRTAFAIAAYERTLLANKAPFQKWLKGDENAMSAKEVRGAKVFFSSTC
VQCHVGPSLAVSDFRAVGFADHPADFGGLNLGRGAITKRTSDDFKFKVPQLYNLADSSPY
GHGASFKTIREIVEYFNQAEPQKQEAKYSGSLSVWFKPLHLTVDQVDDITSFLEVGLRDP
NLTRYLPKIIPSGLCFPNNDPESRKQLNCDMNLSH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaaggtggcattgaatctaattaaactcagcattattactttatttatagta
ataaatctgggaagtaacagctatgcgttagagatacaaaatttcgataaatcttccgga
ataaatagctttttaaactatcaagtcaaacaaatcatcaaggctgctgcaccgggaaat
aaagggcttgattattttattctgcccgaatcatcagagttagacaaaattcctagtgaa
ccacaaaatccgattacttctgcaaaagttgagctaggaaaagccttatttcacgaaaca
gctttaagtattaatccacttaatcctaaacattggcaacaatccagttgtgcaacttgt
cacatcgcacaagcaggatttcgagccaacattgcacagggcttgggaactgggggttta
ggatggaatcaatttagacaccgcgacccagaaatatcacccgtacaaatcgataagcaa
aatgttctcgttccctctgtacttaacagcgcttatcaaactgtgcaaatgtgggatggt
cgtatcggtgttgcaggcccaaacattaaagaagcaattatcaaaaataatgatgtcaac
cgacatcaattgcaagggttagagacacaaccaatagacggaattgctttccaccgtctg
ggaacagctgcgatcgcgcaaattcccgaataccaaaaaatgtttgcagcagcctttccc
gaccgaccctatgtgagtgctgaacaggaagacaacaaacggacagcttttgcgatcgca
gcttacgaacgcaccctactagcaaataaagcaccgttccaaaaatggctcaagggagac
gaaaatgcaatgtcagctaaggaagtgcgaggagctaaagtattttttagctcaacttgc
gttcagtgtcatgttggaccatctcttgcggtttcagattttcgtgctgtaggatttgca
gaccatccagccgactttggcggacttaatctcggtcgcggagcaattaccaaacgtact
agtgatgactttaagtttaaagtaccccaactttataacttggctgatagctcaccttat
ggtcatggagcatcatttaagacaattcgtgaaatagtcgaatatttcaaccaagctgaa
ccgcaaaaacaggaagcaaaatactcaggtagtctcagcgtttggtttaaacctctgcat
ctaacggtagaccaagttgatgacataacaagttttttagaagttggactgcgcgacccc
aatttgacacgttacttaccaaaaattattcccagtggtctgtgtttccccaacaacgac
ccggaatcacgaaaacaacttaattgcgacatgaacctatcccactaa

DBGET integrated database retrieval system