KEGG   Cylindrospermum stagnale: Cylst_5964Help
Entry
Cylst_5964        CDS       T02398                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
csg  Cylindrospermum stagnale
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cylst_5964
Enzymes [BR:csg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cylst_5964
Peptidases [BR:csg01002]
 Cysteine Peptidases
  Family C44
   Cylst_5964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6677624..6679438
Genome map
AA seq 604 aa AA seqDB search
MCGIAGILTKTKIKNNLEPLILRMQNALQHRGPDDQGIYISPNKQVAFAHTRLSIIDLST
AGHQPMSTSDGRYWITFNGEIYNFQQLRHSLESQGEQFYSNTDTEVILKLYQRQGAECVN
NLRGMFAFAIWDNQEQTCFIARDPLGIKPLYYWQSGSTLVFASEIRAILASKLLTIALSP
QGLYGYLISGTVPEPYTLIEGIRCLEAGHWLHWQTDKLTQQQYWQINFTNATISLTEAKE
KVRNALVDSIKNHFISDVPVGIFLSGGIDSSSVVALARQTQKGNLRTYSIAFEENEWNEG
ALAQRIAKEFDTAHTEYKVTASLGRELLPQFLASIDQPSIDGFNTFCVSQVAHKDGTKVV
LSGLGGDEIFGGYKTFQQVPNMLRWGQQLQKIQPISTGLGRGLASWGKSPRLKRLGDFLQ
QKPTTSAAYRSFRGIFSQREAWKITQHYCEDSWTKFPIWEEGIFQDMNLTTNLPSLEDEV
SFLELTCYMRNQLLRDSDVMSMAWSLELRVPLVDRVLLETIASIPSAMRLAPSKQLLIQA
VPELPNWLLDRPKRGFFFPFQQWIDQEWSDYFPAHELSKNIDLKLWYRRWSLAILDYWLQ
QITG
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattgccggaattttaactaaaactaaaataaaaaacaacttggaacccttg
atactcaggatgcaaaatgctctacagcatcgtggacctgatgaccaaggaatttatatt
tccccaaacaaacaagttgcttttgctcatactcggctttctattattgacctcagtaca
gcaggacatcaaccgatgtctacatctgatggacgctactggattacttttaatggggaa
atctacaactttcaacaattacgacattccttagaatcccaaggagaacagttttattcc
aatactgatactgaagtaattctcaaactttaccagcgtcaaggagcagaatgtgtaaat
aatttgcggggtatgtttgcctttgctatttgggataaccaagaacaaacctgctttatt
gcccgcgatcctttaggaattaaaccactatactattggcaatctggatcaactttagta
ttcgcttcagagatcagagcgattctagcttctaagctacttactattgccttaagtcca
cagggtttatatggttatcttatcagtgggacagtaccagaaccttacaccttaattgaa
ggtattcgctgtttagaagctggtcattggttacattggcagacagataaactaactcag
cagcagtattggcaaattaactttacgaatgcaacaatctctctaactgaggctaaagaa
aaagttcgtaatgctcttgttgactctattaaaaatcactttataagtgatgtgcccgta
gggatatttctcagtggtggtattgattcaagctcagttgttgctttagcacgccaaact
caaaaaggtaatttacgtacttattcaattgcctttgaagaaaatgaatggaatgaaggg
gcgctagctcaaagaattgctaaagaatttgatactgctcatacagaatataaagttaca
gcatctttagggcgagaattattacctcaatttttagctagtattgaccaacctagtatt
gacggcttcaatactttttgtgtttcccaagttgcccataaagatgggacgaaagtagta
ttatctggattagggggagatgagatatttggtggttataaaacatttcaacaagtacca
aatatgctccgttggggtcagcaattacagaagattcaaccaatcagcactggactaggt
aggggattagcttcttgggggaaatcaccacggctgaagcgtttaggagattttttacag
caaaagccgacaacttcagcagcttatcgcagttttaggggtattttttctcaaagagaa
gcctggaaaattactcagcattattgcgaagattcctggactaaattcccaatttgggaa
gagggtatttttcaggatatgaacctaaccacaaatctgccttctttagaagatgaagtc
agctttttagaactgacttgttatatgcgtaatcagttgttgcgagacagcgatgttatg
agtatggcatggagcttagagttgcgagtgcctttagttgatcgcgttttactcgaaaca
atcgcctctattcccagtgcaatgcgccttgcaccaagtaaacagttattaatccaagcc
gttcctgagttaccaaattggttacttgatcgcccgaagcgaggattcttttttcctttt
cagcaatggatagatcaagagtggagtgattattttccagcccatgaactgagcaaaaat
atagacctaaaactatggtatcgtcgttggagtctggcaattcttgactattggttgcag
caaataactggctag

DBGET integrated database retrieval system