KEGG   Cylindrospermum stagnale: Cylst_6350Help
Entry
Cylst_6350        CDS       T02398                                 

Definition
helicase, putative, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csg  Cylindrospermum stagnale
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cylst_6350
Enzymes [BR:csg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cylst_6350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pCYLST.02:118551..120800
Genome map
AA seq 749 aa AA seqDB search
MSTLPKPNPAPQQINTSVPQETITGVVERLTFYSEESGYTVARLTRSSAKDLTTIVGSFA
NIQPGQTLQLTGFWREHPQYGPQFQVINYKETKPATLTGIEKYLGSGLIKGVGPVTAKRI
VAHFGVDTLEIIENQIDRLIEVNGIAKKRIKLIKNAWETQKAIKEVMVFLQGHGVSTIYA
VKIYKQYGDKAIAIVTNNPYQLATDIYGIGFLTADKIARNLGVAPDSQFRYCAGLVHALS
EAAEDGHCYLPQPELIDSVIKLLTTDTHQPTEEAIAQTIKDMALKDELIRERDSDILLCY
KPTYFHTEQNLAQLIHQRLSQPIITDIPRVRAWMERFTASQKIELSPQQQQAVEMAAYSP
IMILTGGPGVGKTFTTHTVVSLWKAMGKSIALAAPTGRAAQRLAEMTGLEAKTIHRLLEF
DPRTRGFKSDNDNPLPQTAIIVDEASMLDLFLAYSLVKAVSDGAQLLLVGDIDQLPSVGP
GSVLADLINSGKVPVVRLTQVFRQAQQSAIITAAHEINRGQYPTIERINDNPVSDCLWHG
GGFQPEHGVQTICELITDLIPKLGFNPATDVQVLCPMTRGLVGTRNLNTVLQELINPKSP
DQVEITRGGMTLRVGDRVIQQTNDYQREVFNGDLGIITDIDTIEQEVNVQYGERSVVYDY
ADLNEITLAWSVSIHKSQGSEYPVVILPLYMQHYMMLSRNLLYTGLTRAKKLAIVIGAKK
AISLAVRSTEDVQRYTRLQQRLISLCEFG
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttaccaaaaccaaaccctgctccccaacaaattaatacttctgttccccaa
gaaacaattacgggagtagtagaacggctaactttctactcagaggagtcaggctacaca
gtggcacggttaactcgctctagtgccaaggatttaacaaccattgttggcagttttgct
aatattcagcccggacaaacactacagctaacaggcttttggcgtgaacatccccaatat
ggaccgcaatttcaagtaatcaattataaagaaaccaaaccagctacacttacagggatt
gaaaagtatttgggcagtggattaattaaaggtgtcggtccagttacagcaaagcggatt
gttgcccattttggagtagacaccctggaaatcattgaaaatcagattgaccgtttaatt
gaagttaacggtatagctaaaaaacgtatcaagttgataaaaaatgcctgggaaacccaa
aaggccattaaagaggtgatggtgtttttacaagggcatggcgtttctactatttatgca
gtcaagatttataaacagtatggggataaagcgatcgctatagtcactaacaatccctac
caattagctactgacatctatggtatagggtttctcactgctgataagattgctagaaat
ctgggagttgcacctgattctcagtttagatattgtgccggacttgttcatgctttgagt
gaagccgcagaagatggtcattgctacttaccccaaccagaactaattgactcggtaatt
aaactgctaacaacagatactcatcagccaacagaagaggcgatcgctcaaactatcaag
gacatggctttgaaagatgagttaatcagagaacgggatagtgatatattactttgctac
aagcctacttattttcacaccgagcaaaacctagcgcaactgatacatcagcgtttgagt
cagcctatcattactgatattccccgcgttcgtgcctggatggagagatttactgctagt
cagaaaattgaactttcaccacaacaacagcaagctgtggagatggctgcttattccccc
atcatgattcttacagggggtccaggagtaggcaaaactttcactacccatacagtagtc
agtttatggaaggcaatgggtaaatctattgctttagctgcaccaactggacgagccgca
cagcgtttggctgaaatgactggtttggaagcaaaaactatacatcgtttattagaattt
gaccccaggacaaggggttttaaatccgacaacgacaaccctttacctcaaacagcaatt
attgttgatgaagccagtatgttagatttatttttagcatactccttagtcaaagcagtt
tcagacggcgcacaacttttattagtgggagatattgaccagttaccgtcagtgggacca
ggtagtgtacttgctgatttgataaattctggcaaagtgccagtggtgcgactaactcag
gtatttcgtcaagctcaacaaagtgcaattattactgctgcccacgaaatcaaccggggt
cagtatcccacaattgaacgaatcaacgataaccctgtttctgactgtttatggcatggc
gggggatttcagccagaacacggggtacagacgatttgtgaattaattacagacttgatt
ccaaaattaggatttaaccccgctacggatgtgcaagtgctttgccccatgacacggggg
ttagtaggtactcgcaacctgaatacagtattgcaggaactgattaatcctaaaagtccc
gatcaggtagaaattaccaggggtgggatgacattgcgggtaggtgacagagtaattcag
cagactaacgattaccaacgggaagtgtttaatggtgatttgggaatcatcacagatatt
gataccattgaacaagaagtaaatgtgcagtatggggaacgttctgtagtttatgattat
gccgacttgaatgaaattactctcgcttggagcgtttctatacataaatcacaaggttca
gaatatccggtggtgattttacctttgtatatgcaacactatatgatgcttagtcgtaat
ctgctttatacaggtttgactcgtgctaaaaagttagcaattgtgattggtgcaaaaaaa
gcaatatccttggctgtgcgctctactgaggatgttcaacgatatacacgcttacaacaa
agattgatatcattgtgtgaatttggttaa

DBGET integrated database retrieval system