KEGG   Clostridium saccharolyticum WM1: Closa_0062Help
Entry
Closa_0062        CDS       T01288                                 

Definition
glycoside hydrolase
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Closa_0062
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Closa_0062
Enzymes [BR:csh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Closa_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
70179..73169
Genome map
AA seq 996 aa AA seqDB search
MTRRTKKRWEDQTLGHIGRREARTEFYKDSASRINLNGEWRFLYLEAPELSPEGFMNRET
GTDWDLIDVPSVWQLRGYDRMHYTDVLYLFPINPPFVPSENPTGIYKKTVHLNREWIQKD
TILKFHGVDSAFDVWVNGTHAGYSKVSRLPSEFDITGYVQEGDNDITVRVYKWSDGTYLE
DQDMWWLSGIYRDVELINEPKDSIIDCTVEGDLDSTYKNGILKANITTKQKTCEGIWKLE
RDGQVVTRGIFQAEEGKAQVRETIPGAELWTAETPGLYELTVSAGNHEIVVRVGFRKVEI
KDNNFRVNNQVILLNGVNHHDFHPKEGRCVTREQMEADILLMKQNNINALRCSHYPANGY
LYDLCDEYGLYVIDEADLECHGFEWVERYDWITDDPSWKEAYVDRSVRMVKRDRNHPCII
MWSMGNESSFGCNFKSAAEAVKELDPGRLLHYEGDYEAEVADVYSTMYTRLNRLKEIGES
DIKGNKPHVMCEYGHAMGNGPGGLKAYQELYRKYKRLQGGFLWEWYDHGIYTEEGKETYY
RYGGNYGDFPTNGNFCIDGLLMPDRTPSPAMLEYKQVIAPVEVIRAGTGREVLVRNHYDF
LTLGHVTLKWEIRTEEHNIQEGTITHMTALPHEEEKVTIPFLPFLPEANTDYYLNITVCQ
KEDTNFAKAGHEISKVQFPLNISCDVLEERPKGEPLQVSETTDLLKVENGAVTVTFHKIF
GKLLSVGAGDQVYINEGPVMNVYRATIDNDMYKKEDWLNKYFIQKSSEQTEYFTYQTEAD
QVVVSIGKYFGCLNQSWGFECDYEYTIYSCGQVKVDLKGKAVQRGKLEPSFLPRIGVVMK
GNKSLQNAVWYGLGPGENYSDSKAASLMGIYSSSVDEMGTNYVFPQENGHREEVKWFGIG
DGNKSLLCKMEAPMGLNLGNYTDESLEEAKHPFQIQRADHVEIHLDYLQSGLGSNSCGEE
QLEEYKVKLQDFSMAFVMQVVDDGEVRKEAKKHYLD
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcgaacaaaaaagagatgggaagaccagaccctggggcatattggaagaagg
gaagcccgtacagagttttataaagattctgcttccagaattaatttaaatggagagtgg
agattcctctatctggaagcgccggaactgtccccggaaggatttatgaacagagaaaca
ggaacagattgggatttgattgatgtgccttctgtgtggcagttaagaggatatgaccgg
atgcactatacggatgtgttatatttgtttccgatcaatccgccttttgtaccttcggaa
aatcctacaggaatttataaaaaaacagtccatttaaacagggagtggattcagaaggat
acgattttaaaatttcacggtgtggacagtgcctttgatgtatgggtcaacgggacccat
gcaggatacagcaaggtcagccgtcttccaagtgaattcgatattaccggctatgtacag
gaaggggacaatgacattacagttcgggtctataaatggtccgatggtacttatttggaa
gaccaggatatgtggtggctttccgggatttaccgtgatgtggaattaatcaatgagcca
aaagacagtatcattgattgtacggtggagggagatctggacagtacttataaaaatggg
atcttaaaagccaatattaccacaaaacagaaaacgtgtgaaggtatatggaaattagag
agagatggccaggtggttactcgtggcatctttcaggcagaagaagggaaggcacaagta
agagagacgattcccggtgcagagctttggacggcagaaacccctggtttatacgaatta
acagtatctgcaggcaatcatgaaattgtggttcgtgtgggattccgtaaggtggaaata
aaggataataacttcagagtaaacaaccaggtgattctgttaaatggtgtgaaccatcat
gactttcacccaaaagaaggacgctgcgtcactcgggaacagatggaagctgatatcctg
cttatgaaacagaataatatcaatgcactgcgctgttctcattaccctgccaatggatat
ttatatgatttatgcgatgaatatgggctttatgtgattgatgaggcagatctggaatgc
catggatttgaatgggtagagcggtatgactggattacagatgacccgtcctggaaggaa
gcctatgtggacagaagtgtgcgcatggtaaagcgggaccggaatcatccatgcattatc
atgtggtccatgggaaatgaatccagcttcggctgcaattttaaaagtgccgctgaggcg
gtgaaagagctggaccctggaaggctgcttcactatgaaggagattatgaagcagaagtg
gctgatgtgtattccactatgtacacaaggctgaatcggttaaaggagattggagaatca
gatataaaagggaataaacctcatgttatgtgtgaatatggccacgccatggggaatgga
ccgggcggattaaaggcatatcaggagctgtaccgcaaatataaacggcttcaaggcggg
tttctgtgggaatggtatgatcatggaatttatacggaagaaggcaaagaaacctattac
cgttatggaggcaattacggggattttcctaccaacgggaatttctgtatcgacgggctg
ctgatgccggatagaaccccttcccccgctatgctggaatacaaacaggtcattgccccg
gtggaagtgataagggcaggtacaggacgggaggttcttgtaaggaaccattatgacttc
ctgacactgggtcacgttacattaaagtgggagatccggacggaagaacataatattcag
gaaggaaccattacccatatgaccgccctccctcatgaagaagaaaaggtaaccataccc
ttccttccgttcctgcctgaggcaaataccgattactatctgaatataacggtatgccag
aaagaagatacgaattttgcaaaagccggccatgaaatttcaaaagtacagtttccattg
aatataagctgtgatgtattggaggaacgtccaaaaggagaaccattacaagtatctgaa
accacggatctccttaaggtagaaaatggggcggttacggtaaccttccataaaatattt
gggaaactgctttctgttggagcaggagatcaggtatatataaatgaaggtccggtaatg
aacgtataccgtgccaccattgataatgacatgtataaaaaagaggattggctgaataaa
tatttcattcagaaatccagtgaacagacagaatattttacttatcaaacagaggcggat
caagtagttgtttctataggaaagtattttggatgcttaaaccagtcctggggctttgaa
tgtgactatgaatataccatctattcctgcggtcaggtcaaagtggatttgaagggcaag
gcggttcagagaggaaaactggaaccttcttttcttcccagaatcggtgtggttatgaag
gggaataagtccctgcaaaatgcagtgtggtacggacttggccccggtgaaaactattct
gacagcaaagctgccagccttatggggatttattccagctctgtggatgagatgggaacc
aattatgtatttccccaggaaaacggccacagggaagaagtaaagtggtttgggatagga
gacgggaacaagagcctgttatgtaagatggaagcacctatgggactgaatcttgggaat
tatacagatgaaagcctggaagaggcaaaacacccattccagatacaaagggcagaccat
gtggagatccatttggattatttgcaatccggacttggaagcaatagctgcggagaggaa
cagttagaagaatataaagtaaagcttcaggacttttctatggcatttgtgatgcaggtt
gttgatgatggggaagtaagaaaggaagcaaagaagcattatttggactag

DBGET integrated database retrieval system