KEGG   Clostridium saccharolyticum WM1: Closa_0073Help
Entry
Closa_0073        CDS       T01288                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:csh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:csh00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:csh00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csh00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:csh00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:csh00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
85677..86621
Genome map
AA seq 314 aa AA seqDB search
MGMKCVGVDVGGTSVKIGVFEVTGELLHKWEVPTRKEEGGKYILNDTAASIRKTLEELGI
PLEEVKGVGMGVPGPVMPSGYVEVCVNLGWRDMYPEKELSEMLDGIPVKSGNDANVAALG
EMWQGGGKGYDDIVMVTLGTGVGGGVIIDQKIVAGKHGLAGEIGHIHIRDDETESCNCGG
VGCVEQISSATGIAREARRKMAAVDTPSVLRTFGDKVTAKDVLDAAKEGDSLACEVMDVV
GHYLGLALAQISMVTDPEVFVIGGGVSKAGAFLIDVLYKHFDKYTPISQNKSGIVLAKLG
NDAGIYGAARLILD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgaaatgtgttggcgttgatgtcggcggtacatctgtaaagatcggagtattt
gaagtgacgggggagctcctccataagtgggaggttcccacgagaaaggaagagggagga
aaatacatcctgaatgatactgccgcttccatacggaaaaccctggaagagcttggcatt
cccttagaagaggtaaagggagtaggtatgggagttccggggcctgtcatgcccagcgga
tatgtggaggtatgcgtaaatttaggctggcgtgatatgtatccggaaaaagaactgagt
gaaatgctagacggcattcctgtaaaaagcggcaatgatgccaatgtagcagcacttggt
gaaatgtggcaaggaggcggcaaaggttatgatgacatcgtgatggtcactcttggcaca
ggagtgggcggaggcgtcatcattgaccagaagattgtagccggaaagcatggcctggcc
ggagagatcggacacattcatatccgtgatgatgaaacggaaagctgcaactgcggcggc
gttggctgtgtggaacagatttccagcgccacaggcattgcacgggaagccagaagaaaa
atggctgccgttgatacgccctcggttctcagaacattcggcgacaaggtaacggcaaaa
gatgtgcttgatgctgccaaggagggtgattcactagcctgtgaggtcatggatgtggta
ggccattatcttggccttgccctggctcagatttccatggtcacagacccggaggtcttt
gtcattggcggaggcgtttcaaaagccggagccttcctgatagatgtactctataagcat
tttgataagtacactcctatttcccaaaataagagcggaatcgttttggcgaagctggga
aatgatgcaggaatatatggtgcggccaggctcatcctggattaa

DBGET integrated database retrieval system