KEGG   Clostridium saccharolyticum WM1: Closa_0126Help
Entry
Closa_0126        CDS       T01288                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(145897..147807)
Genome map
AA seq 636 aa AA seqDB search
MEIDRAEIGTGFITEVDRYLYNNGRHYEIYEKLGAHPEKYEGNDGMYFAVWAPHGSQVSV
VGDFNGWDPEANLMSSLSDSGIWETFVPGLGIGELYKYAITTRSGKILFKSDPYAFQAEY
RPQTASVTADLSVFQWKDRSWMEKRMTKDPLHEPLSIYEVHLGSWRKKNRAEKDGFYTYT
EAAHELADYILEMGYTHVELMGIAEHPYDGSWGYQVTGYFAPTSRYGTPEEFMYFVDYLH
RKGIGVILDWVPAHFPKDAHGLADFDGEPCYEYGDPRKGEHPDWGTKVFDYSKYEVDNFL
IANALYWVDKFHVDGLRVDAVASMLYLDYGRNNGEWVPNQYGGNENLEAIEFFKHLNSVI
KNRGNGAMVIAEESTAWPRVTGNQEQAGLGFTFKWNMGWMHDFLEYMKLDPYFRKYNHHK
MTFGLSYFTSENYILVLSHDEVVHLKCSMIHKMPGLLEDKFSNLKLGYTFMLGHPGKKLL
FMGQDFGQFHEWDEKSALDWYLSEEPLGKDLKDYVRDLLHLYKKYPALYEKDFDWEGFSW
VNANDKERSIFSFIRYSKDHKRSLLFVLNFTPVERPDYRVGVPKRGAYTLVLDEKHGLYK
RGEKAPSFRSVKTEWDGQEHSFSYPLPAYGAAVFRF
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagacagagctgaaatcggaaccggatttatcacagaagttgaccggtacctt
tataacaatggaaggcattacgaaatctatgaaaagctgggcgcccatccggaaaaatat
gaaggaaacgacggaatgtattttgccgtctgggcacctcatggcagtcaggtcagtgtg
gttggagattttaacggctgggatcctgaggcaaacctgatgtcatccctttccgactcc
gggatatgggaaacctttgttccgggcctgggcatcggggaactgtataaatatgcaatc
accaccagaagcggcaagatccttttcaagtcggatccctacgcctttcaggcggagtac
cgtccccagaccgcttcggttactgcagacctgtctgtttttcagtggaaggaccggtca
tggatggaaaagcggatgaccaaagacccgcttcatgagcctcttagtatctatgaggtg
catttgggctcctggcggaagaaaaacagagcggaaaaggatggtttctatacatacaca
gaagccgcccatgaactggcggactatatactggaaatgggctacacccatgtggaactg
atgggcattgcagagcatccctatgatggctcctggggttaccaggttacaggatatttt
gccccgacatcccggtatgggactccagaagaattcatgtattttgttgattacctgcac
agaaagggaatcggggtcatccttgactgggttcctgcccattttcctaaggatgcccac
ggactggcagattttgacggagaaccctgttatgaatatggggatccccggaaaggcgaa
catccggattggggtacaaaggtttttgattacagcaaatatgaggtagataatttcctt
atagccaacgccctttactgggtggataaattccatgtagacggcctgcgggtggatgca
gtagcttccatgctttatctggattacggcagaaacaacggggaatgggtcccaaaccaa
tacgggggaaatgagaatctggaggccattgagttttttaagcatttaaacagtgtcatt
aaaaaccggggaaacggggccatggtcattgcagaggaatccaccgcctggcccagggtc
accggaaatcaggagcaggcaggccttggctttacctttaaatggaacatgggctggatg
cacgattttttggaatacatgaagctggatccctatttccgtaaatacaaccaccataag
atgacctttggtctttcatattttaccagcgaaaactatatactggtattgtcacacgat
gaggtagtgcatttaaaatgctccatgatccacaaaatgccgggacttctggaggataag
ttttccaatctaaaattgggatatacctttatgctgggccatcccgggaaaaagctgctg
tttatggggcaggatttcgggcaattccatgaatgggatgaaaagtcagccttagattgg
tatctgtcagaggagcctttaggaaaagatctgaaggattatgtaagggaccttcttcac
ctgtataaaaaatatccggccctttatgagaaggattttgactgggagggattttcctgg
gtcaatgccaatgacaaggaacgcagcatcttcagttttatccggtacagcaaggatcac
aagcgcagtctcctgtttgttttaaactttactccggtggaacgcccggattaccgggtg
ggagttccaaaacgcggagcctataccctggtattagatgaaaaacacggattgtacaag
aggggagagaaagcgccgtctttccgttccgtaaagacggaatgggatgggcaggaacac
tccttctcttatcctcttccggcttatggcgctgccgttttccgtttctag

DBGET integrated database retrieval system