KEGG   Clostridium saccharolyticum WM1: Closa_0173Help
Entry
Closa_0173        CDS       T01288                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Closa_0173
   01230 Biosynthesis of amino acids
    Closa_0173
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_0173
   00030 Pentose phosphate pathway
    Closa_0173
   00051 Fructose and mannose metabolism
    Closa_0173
   00052 Galactose metabolism
    Closa_0173
  Energy metabolism
   00680 Methane metabolism
    Closa_0173
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Closa_0173
Enzymes [BR:csh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Closa_0173
Protein phosphatases and associated proteins [BR:csh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Closa_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
188226..189305
Genome map
AA seq 359 aa AA seqDB search
MIRIGMLTSGGDCQSLNATMRGVAKALYRICGEVEIVGFEDGYKGLIYGDYRIMKQEDFS
GILTKGGTILGTSRQPFKLMRTPDENGLDKVEAMKHTYRKLKLECLVVLGGNGSQKTANL
LHEEGLNVVSLPKTIDNDLWGTDTTFGFQSAVNVATNAIDCIHTTAASHGRVFIVEVMGH
KVGWLTLYAGIAGGADIILLPEIPYDLGIIVEALKTRTKNGKKFSILAVAEGAISKEDAC
LTKKELKEKKKKAVVYPSVAYEIGAQITERTGQEVRVTVPGHMQRGGDPCPYDRVLSTRL
GAEAAKLINNKEYGYMVAVNNDEIVKIPLADVAGKLKTVDPKSSIVKEAKMIGISFGDE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgataagaattggaatgcttacaagcgggggcgactgtcagagtttgaatgccaccatg
cgcggtgtggctaaggcactgtaccggatatgcggcgaagtggaaattgttggatttgag
gatgggtacaaagggctgatttacggggattaccgtataatgaagcaggaagatttttcc
ggaatcctgacaaagggcggaaccattctcggcacctccagacagccgtttaaacttatg
cggacacctgatgagaatggtctcgacaaggtggaagccatgaagcatacttatcgaaag
ctgaaactggaatgtctggtggtgttaggcggcaacgggagtcagaaaacggccaatctc
cttcatgaggaggggctgaatgtggtatcccttcctaagaccattgacaacgatttgtgg
ggaactgatactacctttggtttccagagcgccgtcaatgtggccaccaatgccatagac
tgcatccatacaacagcggcttctcatggacgggtcttcattgtggaagttatgggacat
aaggtaggctggcttaccctgtatgcaggaattgcaggcggggcggacatcatccttctt
ccggagattccctatgatctgggtattatagtggaagcattaaaaaccaggacaaaaaac
ggcaaaaagttttctattcttgctgtggcggaaggagcaatttccaaggaagatgcctgc
ctgacgaaaaaagaattaaaggaaaaaaagaagaaggccgtggtttatccttctgtagca
tatgagatcggagctcagatcactgagcgcaccgggcaggaagtacgggtcaccgtacca
ggccatatgcagaggggcggcgatccatgcccctacgacagagtgctttccacccgtctt
ggagcagaagcagcaaagctcataaataacaaagaatacggttatatggtagcggtgaac
aacgatgaaatcgttaagatccccttagccgacgtagccggaaaattaaaaactgtcgat
ccgaaaagctctatcgttaaggaagccaagatgataggcatcagcttcggcgacgaataa

DBGET integrated database retrieval system