KEGG   Clostridium saccharolyticum WM1: Closa_0176Help
Entry
Closa_0176        CDS       T01288                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Closa_0176
DNA repair and recombination proteins [BR:csh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Closa_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
191302..191898
Genome map
AA seq 198 aa AA seqDB search
MNYYSSQITRLIEELSRLPGIGSKSAQRLAFHIINMPEEQVAGLASSITEAKRNVRYCKE
CFTLTDQEMCPICRSEKRNHKVIMVVEDTRDLAAYEKTGKFDGVYHVLHGAISPMLGIGP
GDIKLKELMQRLQGDVDEVIIATNSSLEGETTAMYISKLIKPTGIRVTRIASGVPVGGDL
EYIDEVTLLRALEGRVEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaattactacagcagtcagataacaagattaattgaagagctgtccagacttccgggc
ataggcagtaaatctgcacagcgcctggcatttcatattatcaacatgcctgaggaacaa
gtggcaggcctagcttcatccattacagaagcgaaacggaatgtgcgctattgcaaggaa
tgctttaccttaacggatcaggagatgtgtcccatctgccggagcgaaaaacgcaatcat
aaggtgatcatggtagtggaggacaccagggacctggccgcatatgaaaaaacaggtaag
ttcgacggagtttaccacgttctgcacggggcgatttctcccatgctgggaatcggacct
ggtgacataaaactaaaggaactgatgcagaggctgcagggagatgtggatgaggtgatc
attgccaccaattccagccttgagggagagacaacggctatgtatatcagcaagctgatc
aaacccacagggatcagggttacccgtatagccagcggagtacccgttggaggagactta
gagtacatagatgaggtgacattgttacgggccctggaaggccgggtcgaattgtag

DBGET integrated database retrieval system