KEGG   Clostridium saccharolyticum WM1: Closa_0319Help
Entry
Closa_0319        CDS       T01288                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Closa_0319
  Lipid metabolism
   00561 Glycerolipid metabolism
    Closa_0319
   00600 Sphingolipid metabolism
    Closa_0319
Enzymes [BR:csh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Closa_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(340325..341647)
Genome map
AA seq 440 aa AA seqDB search
MVKITFMGAGSTIFARNVLGDCMCTPVLSDAQIALYDIDPVRLADSELILNAINKNVNQG
RADIKTYLGVENRKKALSGATFVVNAIQVGGYDPCTIIDFEIPKKYGLRQTIADTLGIGG
IMRGLRTIPVMEDFARDMEEVCPDAYFLNYTNPMAILTGYMQRYTSIKTIGLCHSVQVCS
ETLLKELDMEDKLEGRTELIAGINHMAWLLKLHDKAGNDLYPMIRQKALEKNQMEKHKDM
VRLEYISHLGYYCTESSEHNAEYNPLFIKSGYPDMIDEFQIPLDEYPRRCIKQINEWEAE
KNSILNHGEITHTRSREYASYIMEAILTNKPYKIGASVLNQGLIHNLPADACVEVPCLVD
GSGITPCHVGRIPTQLAAMNMTNINPQLLTIEAAHTRDRKTIYQAAMLDPHTAAELSLKD
IRSMVDELIEAHGDYMKMYR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaataacttttatgggcgctggaagcacgatatttgccagaaatgtactgggc
gactgcatgtgcacaccggtactttctgatgctcagatcgccctatacgacattgacccg
gtccggcttgctgattcagagctgattcttaatgcaatcaacaaaaatgtgaatcagggg
cgggctgacataaaaacttatctgggagtggaaaaccggaaaaaggcactgtccggcgcc
acctttgtcgtgaacgccatccaggtaggcggatatgatccctgtaccatcattgacttt
gagatccctaaaaagtatggcttaaggcagaccatcgcggatacccttgggatcggcggc
atcatgaggggattaaggaccattcctgttatggaggattttgccagagacatggaagaa
gtttgtcctgatgcatatttcttaaattataccaatcccatggcaatcttaaccggctac
atgcagcgctatacgtccattaaaaccattggcttatgccacagcgttcaggtatgctca
gaaactctattaaaggagcttgacatggaggataagctggagggtaggaccgagctgatt
gcaggaatcaaccatatggcctggctcttaaagcttcatgacaaggcgggtaatgacctc
taccctatgatccgccagaaggcccttgagaaaaatcagatggaaaagcataaagatatg
gtccgtttggagtacatcagccatttgggctattattgtacggaatccagtgaacataat
gcggaatacaatccattgtttataaaatccggatatccggatatgatcgatgaattccag
atccctctggatgagtatcccagacgctgcatcaagcagatcaacgaatgggaagcggaa
aaaaactctatattaaatcatggggagatcacccatacccgctcccgtgaatacgcctcc
tacattatggaagccatcctgaccaacaagccatacaagatcggcgcaagtgtattaaac
caaggtctgatccataatcttcctgccgatgcctgtgtggaagtcccctgtcttgttgat
ggaagcgggatcaccccctgccatgtaggccgtatccctacccagctggcagccatgaat
atgaccaacatcaatccccagcttctcaccatagaagcagcccataccagagacagaaaa
accatataccaggctgccatgctggatccacatactgctgccgagcttagtttaaaggat
atccgttccatggtggacgaactcatagaagcccacggcgattacatgaaaatgtaccgt
taa

DBGET integrated database retrieval system