KEGG   Clostridium saccharolyticum WM1: Closa_0395Help
Entry
Closa_0395        CDS       T01288                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Closa_0395
Enzymes [BR:csh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Closa_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
431524..433749
Genome map
AA seq 741 aa AA seqDB search
MATVCGFVEKIKYRNEDNGYTVLSLVDAGEEYTLVGSFHYISEGEMIEAVGSMTEHPVYG
EQMTVESYEIKAPEDTAAMERYLGSGAIKGIGAALAARIVRRFKADTFRIMEEEPERLSE
VKGVSEKMAMSISQQVEDKKEMRQAMMFLQEYGITMNLAVKIYQEYGPRLYGVLKENPYQ
MADDIPGVGFKMADEIARKAGIFTDSDFRIKCGVQYTLLQATANGHTYLPEEELLSQASE
LLRIEVSYIEKHLMDMQLDKRLVIRESEGKRIVYAAQYYYMELNVAKMLHDLNIRGQMPE
EEIRHQLFKIQNEEQIELDEKQIQAVVEAVNSGLLIITGGPGTGKTTTINTIIRFFESQE
MEILLAAPTGRAAKRMTEATGYEARTIHRLLELTGVPGDDRSIGMHFERNEENPLDADAV
IIDETSMVDIHLMQSLLKAINPGTRLILVGDVNQLPSVGPGNVLRDMIDSQGFNVVMLTK
IFRQATQSDIVVNAHKINRGEQVPLGKKSNDFLFIKREDPNAIINAMITLVQDKLPGYVH
AKTYDIQIMTPMRKGAIGVERLNAILQEYLNPPGDGKAEKEAAGVIYRVGDKVMQIKNNY
NIEWEVRNGYGIPVDKGTGIYNGDMGIVREINSFAELVTVEFDEGRMVDYSFKQLEELEL
AYAITIHKSQGSEYPAVVIPVFSGPRMLMTRNLIYTAVTRAKSCVCLVGMPEVFGDMVNN
EMEQRRYSGLKERICEITRIS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtctgcggatttgtagaaaaaattaaatacaggaacgaagacaacggttat
accgtcttaagccttgttgacgctggagaagaatatacccttgtggggagttttcactac
ataagcgagggagaaatgatcgaagcggtaggttctatgactgagcacccggtttatgga
gagcagatgaccgttgaaagctatgagatcaaggctccggaggacactgcggccatggaa
cggtacctggggtcaggggccatcaaagggatcggggcggctttggcagccagaatcgtc
cgccgctttaaagcggataccttccgcatcatggaggaagagccggagcggctttccgaa
gtaaagggagttagtgaaaagatggcaatgtccatttcccagcaggtagaggacaaaaag
gaaatgcgccaggccatgatgttccttcaggaatatgggattaccatgaatctggcggta
aagatttatcaggaatatgggcccaggctttacggcgtattaaaggagaacccttaccag
atggcggatgatattccgggggtaggatttaaaatggcagatgagattgccagaaaagcc
ggcattttcacggattcggatttccgtatcaaatgcggggtgcagtacaccctgctgcag
gcgacggcaaacggccatacgtatctgccggaggaagagcttctttcccaggcttcggag
cttcttcgtatagaagtgtcctatatagagaagcatttgatggacatgcagctggataag
cgccttgtcatccgcgaatcagaaggaaaacgcattgtttacgccgctcagtactattac
atggaactgaatgtggcaaagatgcttcatgatttaaatatcagaggtcaaatgccggaa
gaggaaatccggcaccagctttttaagattcaaaacgaagagcagatcgagttggatgaa
aagcagatccaggcggtggtggaagcggtcaacagcgggcttctcatcatcaccggaggg
cctggcaccggtaagactaccacgatcaataccatcatacgattctttgaaagtcaggaa
atggagattctgctggcagctcccaccggcagagcggcaaagaggatgacagaagccacc
ggttatgaagccaggaccattcaccggcttttagagctgaccggagttccgggagacgac
cgctccattggaatgcattttgagcggaatgaggaaaatcccctggacgccgatgcagta
atcattgatgagacatccatggttgatattcatttgatgcagtctctgttaaaggccatt
aatccgggtacaaggcttatcctggtgggagatgtgaaccagcttcccagtgttggacca
ggaaacgtgctccgggacatgatcgattcccaaggctttaatgttgtcatgctgaccaag
attttccggcaggccacccaaagcgacatcgtggtcaatgcccataagatcaaccggggg
gaacaggtgcctttgggaaagaagagcaatgattttctgtttatcaagcgagaggatccc
aatgccatcattaatgccatgatcactctggttcaggacaagctgccgggttatgtccat
gcaaagacctatgatatccagattatgacgcccatgagaaaaggggctattggcgtggaa
cggcttaatgccatattacaggaatatttaaatcctcccggggatgggaaggcggaaaag
gaagctgcaggggtcatttaccgggtaggggataaggtcatgcagatcaagaacaattat
aacattgagtgggaggtccgcaatggatacggcattcctgtggacaagggaacgggcatt
tacaacggagatatgggaattgtccgggagatcaattcctttgccgagctggtgacggtg
gaattcgacgaaggccgcatggtggattacagctttaaacaactggaggagctggagctt
gcctatgccattaccattcataaatcccaggggagcgaatatccggcagttgtcatccct
gtcttttccggacctaggatgcttatgaccagaaatctgatttataccgcggtgacccgt
gcaaaatcctgcgtttgtcttgtaggaatgccggaggtcttcggggatatggtaaacaat
gaaatggaacagcgcagatattccggcttaaaagaacggatctgtgaaatcacccggata
tcttaa

DBGET integrated database retrieval system