KEGG   Clostridium saccharolyticum WM1: Closa_0463Help
Entry
Closa_0463        CDS       T01288                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Closa_0463
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Closa_0463
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Closa_0463
Enzymes [BR:csh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Closa_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
526550..528034
Genome map
AA seq 494 aa AA seqDB search
MELSYQSTRGGEAGVTASQAILKGLAEDGGLFMPCFIPKLDKSMKELSAMTYQETAYEVM
KLYLTDYSEGELKTCIERAYDSKFDTEEIAPLAKAGGSYYLELYHGSTIAFKDMALSILP
HLMTVAAKKNEVKNKIVILTATSGDTGKAAMAGFADVEGTEIIVFYPKDGVSRVQELQMV
TQKGENTHVAAIHGNFDDAQTGVKKIFGDKEFARKLAEKGFQLSSANSINIGRLVPQVVY
YVYAYAKLLSSGEIADGEVINVTVPTGNFGNILAAYLAKQMGVPIKTLICASNENKVLYD
FFQTGTYDRNRDFILTSSPSMDILISSNLERLIYLSAGCDADANAAFMKDLSENGAYTVT
DFMRGFMDDFKGGFAGEEETRAAIKKVFDDTGYLMDPHTGVAACVYDRYRTKTKDHTKNV
IASTASPYKFSRSVLEAMEGKQEEPDEFRVIDHLAEVSRVPVPQAVEEIRTAPVRHNTEC
DVDKLKEAVEGFLS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaattatcctatcaaagcaccaggggcggtgaagccggtgtaacggcttcccaggca
atcttaaagggactggcagaagacgggggcctgtttatgccgtgttttatcccaaagctt
gacaaatccatgaaggaactgtcggcaatgacatatcaggaaacggcctatgaggtcatg
aagctgtaccttacggattattcagagggggagttaaaaacctgcattgaacgggcttat
gacagcaaattcgatacagaggagattgctcccttagcaaaggccggcggctcctattat
ctggaattatatcatggtagtaccattgcatttaaggatatggctctttccattctccct
catctcatgaccgttgccgcaaaaaagaatgaggtaaaaaataaaattgtgatcctcacg
gctacctccggagatacaggaaaagctgccatggcaggctttgccgatgtggaagggacg
gaaatcattgtattttacccaaaggatggggtaagccgggtccaggagcttcagatggtg
acccagaagggagaaaacacccatgtggctgccattcatggaaactttgacgatgcccag
acaggggtgaagaagattttcggtgataaggaatttgcacgtaaactggctgaaaagggc
tttcagctttcctctgccaactccatcaacatcggaaggctggttccccaggttgtctac
tatgtctatgcttatgcaaagctgctttccagcggggagatcgcagatggagaagtgatc
aatgtgaccgtacccacaggaaacttcgggaacattctggcagcttacttagcaaaacaa
atgggagttcccattaaaaccctgatctgtgcctccaatgaaaataaagttctttatgat
ttctttcagaccggaacctatgaccggaaccgtgatttcatacttaccagctctccgtcc
atggatattctgatttccagcaacttagagcgcctgatttatttaagcgccggatgtgat
gcggatgcaaatgccgctttcatgaaggacttaagtgaaaacggagcctatacggtaacc
gattttatgaggggattcatggatgattttaagggaggctttgcaggagaagaggagacc
agggcagccattaagaaggtatttgatgatacgggatatctgatggatccccatacaggt
gtggccgcctgtgtgtacgacaggtacaggacaaagacaaaggatcacacaaagaatgtt
atcgcttccacggcaagtccctataaattctcaagaagcgttctggaagccatggaaggg
aaacaggaagagccggatgaattccgggtcattgaccatctggcagaggtctccagggtt
cctgttccccaggcagtggaagaaatccgcactgcaccggtacgccataatacggaatgc
gatgtcgataagctgaaggaagcggtggaaggctttttaagctaa

DBGET integrated database retrieval system