KEGG   Clostridium saccharolyticum WM1: Closa_0519Help
Entry
Closa_0519        CDS       T01288                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Closa_0519
Enzymes [BR:csh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Closa_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
585836..586741
Genome map
AA seq 301 aa AA seqDB search
MIRHLGLKAYGKVNLGLDVLRKREDGYHEVRMIMQTVGLYDKIDIYLKETPGIEVVTNLY
YLPVNENNLVYKAARLLMDEFHVLHGVRIHLNKFIPVSAGMAGGSSDAAAVLFGVNKMFQ
LGLTREELMERGVKIGADVPYCLMRGTALSEGIGEILTPLPDMPQCQILIAKPGISVSTK
FVYEHLDLSVLRKEDHPDIDGMIQAIGNHNIYQVSERLGNVLETVTIPEYPVIARIKDKI
KELGAVNAMMSGSGPTVFGIFTSPRAAQQAYEELRYGEAKNLAKQVYLTNFYNTREVTNE
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgataagacatctgggattaaaagcatacggaaaggtgaatctggggcttgatgtttta
agaaaacgggaagacggataccatgaggtacggatgatcatgcagaccgtaggcctttat
gataaaattgatatttatttaaaagagacaccgggaatcgaggtggttacaaacctatat
tatctgccggtgaatgaaaataatctggtttataaagcggcccggctgcttatggatgaa
tttcatgtccttcacggtgtccgcattcacttaaataaatttattccggtttctgccggc
atggccggggggagcagcgatgcggcagccgttctgtttggagtcaacaagatgtttcag
cttggcctgacaagagaagaattgatggaacggggggtaaaaatcggggcagatgtgccc
tactgtctcatgagagggactgcccttagtgaaggaatcggagaaatcctgacccctttg
ccggatatgccccagtgccagatcctcatagcaaagccagggatcagcgtatcaacaaag
tttgtctatgaacatctggatttatctgtcttaaggaaagaggaccatccggacattgac
ggcatgatccaggcgattgggaatcataacatttaccaggtatcggaacgccttggaaat
gtgcttgagacggttactattccggaatatccggtgatcgcccggattaaggataaaata
aaagaattgggagcggtgaatgccatgatgagcggaagcggtcccacagtatttggcata
tttaccagccccagggccgcacagcaggcttatgaggaattgagatacggcgaagcaaaa
aacctggcaaagcaggtttatctgacgaatttttacaataccagggaggttaccaatgag
caatga

DBGET integrated database retrieval system