KEGG   Clostridium saccharolyticum WM1: Closa_0589Help
Entry
Closa_0589        CDS       T01288                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Closa_0589
Enzymes [BR:csh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Closa_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
661520..663223
Genome map
AA seq 567 aa AA seqDB search
MNSKEDKFSVDYGVMLNAYPDSMGGTLSQITDFLKRPELAEVFRSFYILPSIFNTDLDRG
FSVIDYGLNERMADRKDLEAFKDLGIDLKLDFILNHSSVLSKEFQDILKNGEKSRYRDFF
IDWNKFWEGYGTMTEEGYIQPDEALIKDMFFRKPGLPILMVRLPDGKNVPYWNTFYQEVQ
YKRLDQWDLMQAAEIQYAAAEDLARIVNQELQEGKKPSEIEFESYEKYRDCVVELLESGR
RYLGQMDLNIRSPLVWEYYDNTLKTLSEYGAKIVRLDAFAYAPKAPGERNFLNDPGTWDL
LQKVQDLADQYHLQLLPEIHSGYGEKTYELLAGKGYMTYDFFLPGLIIHALESGSGEYLT
GWAKELKVKKIKVVNMLGCHDGIPLLDLKGLIPDEEIEGLIKTIVGRGGFVKNLHGQKNV
YYQVNATYYSALGEDDKKMLLSRALQLFMPGKPQVWYLDLFAGKNDYEAVKKAGAAGHKE
VNRTNLSLVQIEEKMGLDVVKKQIEMLRFRNNFPAFGFDSDMDIQAVGSEIDITWKKEGY
EARLKADLKTCEYEITGYGQNGFVYPL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtaaggaagacaaattttctgttgattatggagtgatgctcaatgcctatcct
gacagcatgggcggtactttgtctcaaattacggattttttaaaaaggcctgaattagcg
gaggtatttcgttcgttttatattttgccaagtattttcaacaccgatctggaccgggga
ttttcagtaattgattatgggttaaatgaacggatggcggacagaaaggatcttgaagcg
ttcaaagacctggggattgacttaaagctggattttattctgaaccattcttctgtgtta
tccaaagagttccaggatattttaaaaaacggagagaaatccaggtacagggatttcttt
attgactggaacaagttttgggaaggttatggaaccatgacagaggaaggctatattcag
ccggatgaagcacttattaaagatatgttttttcggaagccgggtcttccgattttaatg
gtgcgcctgcctgatggaaaaaatgtaccttactggaatactttttatcaggaagtacag
tacaaaaggttggatcaatgggatctgatgcaggcagcagaaatacagtatgcagcggca
gaggatctggcccgtatcgtaaaccaggaattacaggaggggaaaaaaccttctgagata
gagtttgaaagttacgaaaaatacagggactgtgtggtggaactgctggaatcaggacgg
aggtatttgggacaaatggacttgaatatccgttccccgctggtctgggaatattatgac
aatacgttaaaaaccctttctgaatacggtgccaaaatcgttcgcctggatgcatttgcc
tatgcccccaaggctccgggagaaaggaattttttaaatgatccgggaacctgggatctg
ctgcagaaggtgcaggacctggcggatcaatatcatttgcagctgctgccggaaatacat
tccggctacggagaaaaaacctatgagctgttggctggaaaaggctatatgacctatgac
tttttccttccgggccttattatccacgcattggaaagcggcagcggggaatatctgacg
ggctgggcaaaggaactgaaggtaaaaaagatcaaagtggtaaatatgctgggatgtcat
gatggaattccccttttagacttaaagggactgatccctgatgaagaaattgaaggatta
attaagaccattgtgggacggggcgggtttgtcaaaaatctccatggacagaaaaatgtt
tattaccaggtaaacgccacatactacagcgctcttggggaagatgataaaaagatgctg
ctgtcaagagctctgcagctttttatgcctggaaaaccccaggtttggtatctggatctt
tttgcaggtaaaaatgattatgaggctgtgaaaaaggcaggggcagcaggacataaggag
gtgaaccgtaccaatctgtctctggtgcagatagaagagaaaatgggacttgatgtggtc
aaaaagcagattgagatgctgcggttccgaaataactttcctgcatttggttttgattct
gatatggatattcaggccgttggctctgaaattgatattacatggaagaaagaagggtat
gaagccaggctaaaggcagatttaaagacctgcgaatatgaaataaccggatatgggcag
aatggatttgtttatccgctttaa

DBGET integrated database retrieval system