KEGG   Clostridium saccharolyticum WM1: Closa_0685Help
Entry
Closa_0685        CDS       T01288                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00010  Glycolysis / Gluconeogenesis
csh00030  Pentose phosphate pathway
csh00051  Fructose and mannose metabolism
csh00680  Methane metabolism
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
csh01120  Microbial metabolism in diverse environments
csh01130  Biosynthesis of antibiotics
csh01200  Carbon metabolism
Module
csh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_0685
   00030 Pentose phosphate pathway
    Closa_0685
   00051 Fructose and mannose metabolism
    Closa_0685
  Energy metabolism
   00680 Methane metabolism
    Closa_0685
Enzymes [BR:csh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Closa_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ADL03312
JGI: Closa_0685
UniProt: D9R5A6
Position
776603..778540
Genome map
AA seq 645 aa AA seqDB search
MRSLAYLKLMAREYPTIKAASSEIINLTAIQGLPKGTEYFFSDLHGEYEAFVHLLKSASG
VIREKITETFSHIIPEKEEVELANLIYYPERVMNQLELKGMADGDWQRVTIYRLVQICKM
VSSKYTRSKVRKKMPPEFAYIIDELIHVDYNDDNKRVYYNEIIRSIIDIRVGDKFIIALC
ELIQNLTIDSLHIIGDIFDRGPRADIIMDELLRFHDVDIQWGNHDISWMGAATGNLACIC
NVLRIAISYNSFDVLEDGYGINLRPLSMFAAKVYRDDPCDRFIPQILDQNIYDAVDPGLA
AKMHKAIAVIQFKVEGQIIKRHPEYEMNDRVLIEAVDFLRGVVTVEGKEYPMLDMFFPTV
DPKDPLKLSKEEGELLHTLQLSFMHNELLHKHIRFLYSHGSMYKCYNSNLLYHGCIPMKE
DGSFEEIVVDHHSYSGKALMDYVDKKVQNAYFMPEESPESGDARDFMWYLWCGAKSPVYG
KGKMTTFEHYFIEDHASHKEPMNPYYRLSVKEEYCDKILEEFGLSKKGSHIINGHVPVKI
KEGESPVKAGGKLFLIDGGLSKAYQTKTGIAGYTLIYNSNHLALAEHKPFDPNKESTPKV
SVVENMKNRVMVADTDKGVELAERIADLKELVAAYRDGIIKEKVE
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtttggcgtatttgaaactgatggcaagggagtatccgacgataaaggctgct
tccagtgaaatcatcaaccttacggccattcagggtctaccaaagggaacagaatacttt
ttcagtgacttacatggcgaatacgaggcatttgtccatttgctaaaaagtgcttcagga
gtgatccgggagaaaatcacggaaaccttcagccacatcataccagagaaagaagaagtg
gagttagccaatttaatatactatccggaaagggtcatgaatcagctggagcttaagggc
atggcagatggtgactggcagagggtgaccatttacaggctggtacagatctgcaaaatg
gtttcatcaaaatacacccggtcaaaggtaaggaaaaaaatgcccccggagtttgcctac
atcattgatgagctgatccatgtggattataatgatgacaataaacgtgtatactataat
gaaatcattcggtccatcatcgacatccgggtgggagataagtttatcatagccctatgc
gagctgatccagaatctgaccattgacagcctgcatattatcggggatattttcgaccgg
ggtccaagggcggatattattatggatgaactgctccggtttcatgatgttgatattcaa
tgggggaatcatgacatttcctggatgggagcagccaccgggaatctggcatgtatctgc
aatgtactgaggatcgccatcagctataacagctttgatgtgctggaggatggatacggc
ataaacctgcgcccgttatccatgtttgctgcaaaggtttaccgggacgatccctgtgac
cggttcattccccagatcttagaccaaaacatatacgatgcggtggatccgggactggca
gccaagatgcacaaggccattgctgtcatccagtttaaagtggaagggcagatcataaaa
cgccatccggaatatgagatgaatgaccgggtcctgattgaggctgttgattttttacgg
ggagttgtgaccgtggaggggaaggaatacccaatgctggatatgttctttccaacggtt
gatcccaaggatccgctaaagctcagtaaggaggaaggagagcttcttcataccctgcag
ctttcctttatgcataacgagcttcttcataagcatatccggttcctttattcccatgga
agtatgtataaatgttataattcaaatctgctgtaccatggctgcattcccatgaaggag
gacggctcctttgaggaaatcgtggtggaccatcattcttattcgggaaaggccctgatg
gattacgtggataagaaggttcaaaatgcatattttatgccggaagaatccccggaaagc
ggggatgcaagggattttatgtggtatttatggtgcggggccaaatccccggtttacggc
aaggggaaaatgaccacctttgagcattattttattgaagaccatgcctctcataaagag
cctatgaatccttattacagactcagtgttaaggaagaatattgtgataagatactggaa
gaattcggtctttctaaaaaaggctcccatatcatcaacggccacgtaccggtgaaaata
aaagaaggggagtcgccggtgaaagcaggcggcaagctgttcctcattgatgggggactg
tcaaaggcttaccagacaaagacagggattgcaggttataccttgatttataattccaac
catctggctcttgctgagcacaaaccctttgacccgaataaagaaagtaccccaaaggtt
tccgtagtagagaacatgaaaaaccgtgtcatggttgcagatacggataaaggcgtggaa
ctggccgaacggatcgcagatctgaaagaactggtggcggcttaccgggatggcataatt
aaggaaaaggtagagtag

DBGET integrated database retrieval system