KEGG   Clostridium saccharolyticum WM1: Closa_0831Help
Entry
Closa_0831        CDS       T01288                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Closa_0831
   01230 Biosynthesis of amino acids
    Closa_0831
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_0831
   00051 Fructose and mannose metabolism
    Closa_0831
   00562 Inositol phosphate metabolism
    Closa_0831
Enzymes [BR:csh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Closa_0831
Exosome [BR:csh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Closa_0831
  Exosomal proteins of bladder cancer cells
   Closa_0831
  Exosomal proteins of melanoma cells
   Closa_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
902826..903578
Genome map
AA seq 250 aa AA seqDB search
MSRKKIIAGNWKMNMTPSEAVELVNTLKPLVANDDVDVVFCVPAIDIIPAMEAAKGTNIH
IGAENMYYEDKGAYTGEISPAMLKDAGVNYVVIGHSERREYFAETDETVNKKVLKAFEYG
ITPIVCCGESLTQREQGITLDWIRQQIKIAFLGIPAENAAKAVIAYEPIWAIGTGKVATT
EQAQEVCSAIRSCILEIYDEATAEAIRIQYGGSVSAASAPELFAQPDIDGGLVGGASLKP
EFGKIVNYNK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaagaaaattatagcaggtaactggaaaatgaatatgactccctctgaggct
gtggagctggtgaacaccttaaagcctttggtggcaaatgatgatgtagacgttgttttc
tgtgtcccggctattgacatcataccagctatggaagctgcgaaaggaaccaatatccat
atcggtgctgaaaacatgtattacgaggataagggggcttataccggagagatttctcct
gccatgttaaaggatgcaggtgtaaactatgtggtgatcggccattccgagagaagggaa
tattttgctgaaacagatgaaacggtgaacaaaaaagttctcaaggcatttgaatacggc
attactcccattgtttgctgcggagaatccctgactcagagagaacagggaatcaccctt
gactggatccgccagcagattaagatcgctttcttaggtattccggcagagaatgcggca
aaagcagttatcgcttatgaaccgatctgggccattggcaccggaaaagtggcgactacg
gagcaggcccaggaggtttgcagtgcaatccgctcatgcatcttagaaatctatgacgaa
gctaccgccgaagccatccgcattcagtacggcggttccgtatctgctgcaagcgctccg
gagctgtttgcacagcctgatattgacggcggcctggttggcggggcatccttaaagcct
gagtttggtaaaattgtaaactacaacaaataa

DBGET integrated database retrieval system