KEGG   Clostridium saccharolyticum WM1: Closa_0831Help
Entry
Closa_0831        CDS       T01288                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00010  Glycolysis / Gluconeogenesis
csh00051  Fructose and mannose metabolism
csh00562  Inositol phosphate metabolism
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
csh01120  Microbial metabolism in diverse environments
csh01130  Biosynthesis of antibiotics
csh01200  Carbon metabolism
csh01230  Biosynthesis of amino acids
Module
csh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csh_M00002  Glycolysis, core module involving three-carbon compounds
csh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_0831
   00051 Fructose and mannose metabolism
    Closa_0831
   00562 Inositol phosphate metabolism
    Closa_0831
Enzymes [BR:csh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Closa_0831
Exosome [BR:csh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Closa_0831
  Exosomal proteins of bladder cancer cells
   Closa_0831
  Exosomal proteins of melanoma cells
   Closa_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADL03453
JGI: Closa_0831
UniProt: D9R619
Position
902826..903578
Genome map
AA seq 250 aa AA seqDB search
MSRKKIIAGNWKMNMTPSEAVELVNTLKPLVANDDVDVVFCVPAIDIIPAMEAAKGTNIH
IGAENMYYEDKGAYTGEISPAMLKDAGVNYVVIGHSERREYFAETDETVNKKVLKAFEYG
ITPIVCCGESLTQREQGITLDWIRQQIKIAFLGIPAENAAKAVIAYEPIWAIGTGKVATT
EQAQEVCSAIRSCILEIYDEATAEAIRIQYGGSVSAASAPELFAQPDIDGGLVGGASLKP
EFGKIVNYNK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaagaaaattatagcaggtaactggaaaatgaatatgactccctctgaggct
gtggagctggtgaacaccttaaagcctttggtggcaaatgatgatgtagacgttgttttc
tgtgtcccggctattgacatcataccagctatggaagctgcgaaaggaaccaatatccat
atcggtgctgaaaacatgtattacgaggataagggggcttataccggagagatttctcct
gccatgttaaaggatgcaggtgtaaactatgtggtgatcggccattccgagagaagggaa
tattttgctgaaacagatgaaacggtgaacaaaaaagttctcaaggcatttgaatacggc
attactcccattgtttgctgcggagaatccctgactcagagagaacagggaatcaccctt
gactggatccgccagcagattaagatcgctttcttaggtattccggcagagaatgcggca
aaagcagttatcgcttatgaaccgatctgggccattggcaccggaaaagtggcgactacg
gagcaggcccaggaggtttgcagtgcaatccgctcatgcatcttagaaatctatgacgaa
gctaccgccgaagccatccgcattcagtacggcggttccgtatctgctgcaagcgctccg
gagctgtttgcacagcctgatattgacggcggcctggttggcggggcatccttaaagcct
gagtttggtaaaattgtaaactacaacaaataa

DBGET integrated database retrieval system