KEGG   Clostridium saccharolyticum WM1: Closa_1090Help
Entry
Closa_1090        CDS       T01288                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:csh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:csh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:csh00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:csh00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:csh00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:csh00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:csh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1185909..1186883
Genome map
AA seq 324 aa AA seqDB search
MAKQVKTIGVLTSGGDAPGMNAAIRAIVRTAIHKGLEVKGIMRGYAGLLQEEIVDMNSTS
VSDIIHRGGTVLYTARCQEFTTADGQKKGAEICRKHNIDGIVVIGGDGSFRGAGKLSALG
INTIGLPGTIDLDIACTDYTIGFDTAVNTAMEAIDKVRDTSTSHERCSIIEVMGRNAGYI
ALWCGFANGAEDILLPERYDGDEQALINRIIENRKRGKKHHIIINAEGIGHSSSMAKRIE
AATGIETRATILGHMQRGGAPTCKDRVYASIMGAKAVELLCEGKSNRVIGYKHGEFVDFD
IQEALSMTKDIPEDQFQISKMLVR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaagtgaaaactatcggcgtattaaccagcggcggcgatgcaccaggtatg
aatgctgcgatccgtgctattgtcaggactgcaatccataagggattggaagtaaagggg
atcatgaggggatacgcaggccttctgcaggaagaaatcgttgatatgaacagcaccagt
gtatccgatatcatccatcgcggcggaaccgttttatatacagccagatgccaggagttt
accactgccgatgggcagaagaaaggcgccgagatctgcagaaagcataatattgacggc
atagtggtgattggaggagacggttccttccggggagcaggaaagctttctgcccttggg
atcaataccatcggacttcccggaaccattgatttagatattgcctgtaccgattatacc
attggctttgatacagctgtcaacacagccatggaggccattgacaaggtacgggataca
tccacttcccatgaacgctgcagcatcattgaggtaatgggacgtaatgcagggtatatt
gctctttggtgcggttttgccaacggtgcagaagacatcctcttgccggagcgctatgac
ggggatgagcaggccctcattaaccgtattattgagaacagaaagaggggcaaaaagcac
cacatcatcatcaatgcagaggggatcggccactcttcctccatggctaagcggattgaa
gcggcaacaggcattgagaccagagccaccatactgggccacatgcagaggggcggcgca
cctacctgtaaggaccgtgtctatgcttctattatgggcgcaaaggcagtggaacttctt
tgtgagggaaagagcaaccgtgtaatcggctataagcatggagagttcgtagatttcgat
attcaggaagcccttagtatgacaaaggatattccggaagaccagtttcagatctcaaag
atgcttgtaaggtaa

DBGET integrated database retrieval system