KEGG   Clostridium saccharolyticum WM1: Closa_1090Help
Entry
Closa_1090        CDS       T01288                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00010  Glycolysis / Gluconeogenesis
csh00030  Pentose phosphate pathway
csh00051  Fructose and mannose metabolism
csh00052  Galactose metabolism
csh00680  Methane metabolism
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
csh01120  Microbial metabolism in diverse environments
csh01130  Biosynthesis of antibiotics
csh01200  Carbon metabolism
csh01230  Biosynthesis of amino acids
csh03018  RNA degradation
Module
csh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_1090
   00030 Pentose phosphate pathway
    Closa_1090
   00051 Fructose and mannose metabolism
    Closa_1090
   00052 Galactose metabolism
    Closa_1090
  Energy metabolism
   00680 Methane metabolism
    Closa_1090
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Closa_1090
Enzymes [BR:csh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Closa_1090
Protein phosphatases and associated proteins [BR:csh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Closa_1090
Messenger RNA biogenesis [BR:csh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Closa_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase LpxK
Motif
Other DBs
NCBI-ProteinID: ADL03706
JGI: Closa_1090
UniProt: D9R7H7
Position
1185909..1186883
Genome map
AA seq 324 aa AA seqDB search
MAKQVKTIGVLTSGGDAPGMNAAIRAIVRTAIHKGLEVKGIMRGYAGLLQEEIVDMNSTS
VSDIIHRGGTVLYTARCQEFTTADGQKKGAEICRKHNIDGIVVIGGDGSFRGAGKLSALG
INTIGLPGTIDLDIACTDYTIGFDTAVNTAMEAIDKVRDTSTSHERCSIIEVMGRNAGYI
ALWCGFANGAEDILLPERYDGDEQALINRIIENRKRGKKHHIIINAEGIGHSSSMAKRIE
AATGIETRATILGHMQRGGAPTCKDRVYASIMGAKAVELLCEGKSNRVIGYKHGEFVDFD
IQEALSMTKDIPEDQFQISKMLVR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaagtgaaaactatcggcgtattaaccagcggcggcgatgcaccaggtatg
aatgctgcgatccgtgctattgtcaggactgcaatccataagggattggaagtaaagggg
atcatgaggggatacgcaggccttctgcaggaagaaatcgttgatatgaacagcaccagt
gtatccgatatcatccatcgcggcggaaccgttttatatacagccagatgccaggagttt
accactgccgatgggcagaagaaaggcgccgagatctgcagaaagcataatattgacggc
atagtggtgattggaggagacggttccttccggggagcaggaaagctttctgcccttggg
atcaataccatcggacttcccggaaccattgatttagatattgcctgtaccgattatacc
attggctttgatacagctgtcaacacagccatggaggccattgacaaggtacgggataca
tccacttcccatgaacgctgcagcatcattgaggtaatgggacgtaatgcagggtatatt
gctctttggtgcggttttgccaacggtgcagaagacatcctcttgccggagcgctatgac
ggggatgagcaggccctcattaaccgtattattgagaacagaaagaggggcaaaaagcac
cacatcatcatcaatgcagaggggatcggccactcttcctccatggctaagcggattgaa
gcggcaacaggcattgagaccagagccaccatactgggccacatgcagaggggcggcgca
cctacctgtaaggaccgtgtctatgcttctattatgggcgcaaaggcagtggaacttctt
tgtgagggaaagagcaaccgtgtaatcggctataagcatggagagttcgtagatttcgat
attcaggaagcccttagtatgacaaaggatattccggaagaccagtttcagatctcaaag
atgcttgtaaggtaa

DBGET integrated database retrieval system