KEGG   Clostridium saccharolyticum WM1: Closa_1090Help
Entry
Closa_1090        CDS       T01288                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Closa_1090
   01230 Biosynthesis of amino acids
    Closa_1090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_1090
   00030 Pentose phosphate pathway
    Closa_1090
   00051 Fructose and mannose metabolism
    Closa_1090
   00052 Galactose metabolism
    Closa_1090
  Energy metabolism
   00680 Methane metabolism
    Closa_1090
Enzymes [BR:csh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Closa_1090
Protein phosphatases and associated proteins [BR:csh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Closa_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1185909..1186883
Genome map
AA seq 324 aa AA seqDB search
MAKQVKTIGVLTSGGDAPGMNAAIRAIVRTAIHKGLEVKGIMRGYAGLLQEEIVDMNSTS
VSDIIHRGGTVLYTARCQEFTTADGQKKGAEICRKHNIDGIVVIGGDGSFRGAGKLSALG
INTIGLPGTIDLDIACTDYTIGFDTAVNTAMEAIDKVRDTSTSHERCSIIEVMGRNAGYI
ALWCGFANGAEDILLPERYDGDEQALINRIIENRKRGKKHHIIINAEGIGHSSSMAKRIE
AATGIETRATILGHMQRGGAPTCKDRVYASIMGAKAVELLCEGKSNRVIGYKHGEFVDFD
IQEALSMTKDIPEDQFQISKMLVR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaagtgaaaactatcggcgtattaaccagcggcggcgatgcaccaggtatg
aatgctgcgatccgtgctattgtcaggactgcaatccataagggattggaagtaaagggg
atcatgaggggatacgcaggccttctgcaggaagaaatcgttgatatgaacagcaccagt
gtatccgatatcatccatcgcggcggaaccgttttatatacagccagatgccaggagttt
accactgccgatgggcagaagaaaggcgccgagatctgcagaaagcataatattgacggc
atagtggtgattggaggagacggttccttccggggagcaggaaagctttctgcccttggg
atcaataccatcggacttcccggaaccattgatttagatattgcctgtaccgattatacc
attggctttgatacagctgtcaacacagccatggaggccattgacaaggtacgggataca
tccacttcccatgaacgctgcagcatcattgaggtaatgggacgtaatgcagggtatatt
gctctttggtgcggttttgccaacggtgcagaagacatcctcttgccggagcgctatgac
ggggatgagcaggccctcattaaccgtattattgagaacagaaagaggggcaaaaagcac
cacatcatcatcaatgcagaggggatcggccactcttcctccatggctaagcggattgaa
gcggcaacaggcattgagaccagagccaccatactgggccacatgcagaggggcggcgca
cctacctgtaaggaccgtgtctatgcttctattatgggcgcaaaggcagtggaacttctt
tgtgagggaaagagcaaccgtgtaatcggctataagcatggagagttcgtagatttcgat
attcaggaagcccttagtatgacaaaggatattccggaagaccagtttcagatctcaaag
atgcttgtaaggtaa

DBGET integrated database retrieval system