KEGG   Clostridium saccharolyticum WM1: Closa_1209Help
Entry
Closa_1209        CDS       T01288                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_1209
Enzymes [BR:csh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Closa_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1305719..1307185
Genome map
AA seq 488 aa AA seqDB search
MKTKVEYGFPKGFLWGGATAANQIEGACLEDGKGMSTSDYAAYKDPYATGEVNNFTFNVT
SKELEEYRANEEKYKFPKRWGIDFYHRYAEDIALFAEMGFKVFRFSISWVRIFPTGLETE
PNEAGFAFYDKVIAELKKYHIEPLITLSHYEMPIVLSEKYNGWQSRELIDCFVRFAAACF
KRYKNDVKYWITFNEMNMNLNSLYTGAGSFPDKVDHLEQAAYQASHYQFVASSLAVKAGK
EIMPDAKIGCMINRIESYAKTCRPEDQLQALKADQINLFYPEVQARGEYPSYMSRYFKEK
NIMLETEPEDFQIIRDYTVDFIAFSYYMTHVTEDRPDANELAGKLDSPIKNPYLKLTEWG
WPIDPIGLRITLNKMYDRYKKPLFLVENGLGARDKVEADGSIHDDYRIDYIREHVKQMKE
AVTDGVDLMGYTTWGCIDLISCGTSEMTKRYGFIYVDQDDEGNGTLNRSRKDSFYWYKKV
IETNGEEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaagtagaatatggatttccaaagggcttcttatggggaggagcaactgct
gccaaccagatcgaaggagcctgtctggaggatggaaaagggatgtccacatcggattat
gctgcctataaagatccctatgcaacaggagaagtgaataattttaccttcaatgtcacc
tcaaaggaactggaagaataccgggccaacgaggaaaaatataaatttcccaaacgctgg
ggaattgatttttaccatcgatatgcagaagatatcgcattgtttgcagaaatgggattt
aaggtattccggttttcgatttcctgggtaaggatttttcccacaggtctggagacagag
ccaaatgaagccggttttgccttttatgataaggtgatcgccgagctgaaaaagtatcac
atagaacctcttattaccttgtcccactatgaaatgcccatcgttctgtcagaaaagtat
aacggctggcagagccgggagctgattgattgctttgtccggtttgcagccgcatgtttc
aaacgatataagaatgacgtgaaatactggatcacttttaacgaaatgaatatgaattta
aacagcctgtacaccggggcaggcagttttccggataaagtggatcacttagagcaggcg
gcttaccaggcttcccattaccagtttgtggccagttccctggcagtaaaggcgggaaag
gaaatcatgcctgatgccaagatcggctgcatgatcaaccggattgagtcctatgcaaag
acctgcaggccggaagaccagttgcaggcattaaaggctgaccagatcaatctcttttat
ccggaggtacaggcaagaggagaatatccttcctacatgtcacggtatttcaaagaaaag
aacataatgctggaaacagaaccggaagattttcagatcatcagggattacacggtagat
ttcatcgcattcagctattacatgacccacgttacagaggacaggccggatgcaaatgaa
ctggcgggaaaactggacagcccgatcaagaatccttatttaaagctgactgagtggggg
tggcccattgaccctatcgggcttcgcattacactgaacaaaatgtacgaccgttataaa
aagccactgttcctggttgaaaatggacttggagccagggacaaggtggaggcggatgga
agcattcatgatgattaccggatagactatatccgcgagcacgtaaagcagatgaaggag
gcagtaaccgacggagtggatttaatgggctatacgacgtggggctgcattgatttaatc
agctgcggaacatcggaaatgacgaagcgctatggcttcatctatgtggatcaggatgat
gaaggaaatggtacgttaaacagatccagaaaggattccttctactggtataaaaaagtg
atagaaaccaacggagaagaactgtag

DBGET integrated database retrieval system