KEGG   Clostridium saccharolyticum WM1: Closa_1209Help
Entry
Closa_1209        CDS       T01288                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:csh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1305719..1307185
Genome map
AA seq 488 aa AA seqDB search
MKTKVEYGFPKGFLWGGATAANQIEGACLEDGKGMSTSDYAAYKDPYATGEVNNFTFNVT
SKELEEYRANEEKYKFPKRWGIDFYHRYAEDIALFAEMGFKVFRFSISWVRIFPTGLETE
PNEAGFAFYDKVIAELKKYHIEPLITLSHYEMPIVLSEKYNGWQSRELIDCFVRFAAACF
KRYKNDVKYWITFNEMNMNLNSLYTGAGSFPDKVDHLEQAAYQASHYQFVASSLAVKAGK
EIMPDAKIGCMINRIESYAKTCRPEDQLQALKADQINLFYPEVQARGEYPSYMSRYFKEK
NIMLETEPEDFQIIRDYTVDFIAFSYYMTHVTEDRPDANELAGKLDSPIKNPYLKLTEWG
WPIDPIGLRITLNKMYDRYKKPLFLVENGLGARDKVEADGSIHDDYRIDYIREHVKQMKE
AVTDGVDLMGYTTWGCIDLISCGTSEMTKRYGFIYVDQDDEGNGTLNRSRKDSFYWYKKV
IETNGEEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaagtagaatatggatttccaaagggcttcttatggggaggagcaactgct
gccaaccagatcgaaggagcctgtctggaggatggaaaagggatgtccacatcggattat
gctgcctataaagatccctatgcaacaggagaagtgaataattttaccttcaatgtcacc
tcaaaggaactggaagaataccgggccaacgaggaaaaatataaatttcccaaacgctgg
ggaattgatttttaccatcgatatgcagaagatatcgcattgtttgcagaaatgggattt
aaggtattccggttttcgatttcctgggtaaggatttttcccacaggtctggagacagag
ccaaatgaagccggttttgccttttatgataaggtgatcgccgagctgaaaaagtatcac
atagaacctcttattaccttgtcccactatgaaatgcccatcgttctgtcagaaaagtat
aacggctggcagagccgggagctgattgattgctttgtccggtttgcagccgcatgtttc
aaacgatataagaatgacgtgaaatactggatcacttttaacgaaatgaatatgaattta
aacagcctgtacaccggggcaggcagttttccggataaagtggatcacttagagcaggcg
gcttaccaggcttcccattaccagtttgtggccagttccctggcagtaaaggcgggaaag
gaaatcatgcctgatgccaagatcggctgcatgatcaaccggattgagtcctatgcaaag
acctgcaggccggaagaccagttgcaggcattaaaggctgaccagatcaatctcttttat
ccggaggtacaggcaagaggagaatatccttcctacatgtcacggtatttcaaagaaaag
aacataatgctggaaacagaaccggaagattttcagatcatcagggattacacggtagat
ttcatcgcattcagctattacatgacccacgttacagaggacaggccggatgcaaatgaa
ctggcgggaaaactggacagcccgatcaagaatccttatttaaagctgactgagtggggg
tggcccattgaccctatcgggcttcgcattacactgaacaaaatgtacgaccgttataaa
aagccactgttcctggttgaaaatggacttggagccagggacaaggtggaggcggatgga
agcattcatgatgattaccggatagactatatccgcgagcacgtaaagcagatgaaggag
gcagtaaccgacggagtggatttaatgggctatacgacgtggggctgcattgatttaatc
agctgcggaacatcggaaatgacgaagcgctatggcttcatctatgtggatcaggatgat
gaaggaaatggtacgttaaacagatccagaaaggattccttctactggtataaaaaagtg
atagaaaccaacggagaagaactgtag

DBGET integrated database retrieval system