KEGG   Clostridium saccharolyticum WM1: Closa_1696Help
Entry
Closa_1696        CDS       T01288                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Closa_1696
Enzymes [BR:csh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Closa_1696
Exosome [BR:csh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Closa_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1800958..1801941
Genome map
AA seq 327 aa AA seqDB search
MELIYRPRRLRTSDTLRRMVRETRVSKESLIYPLFVVEGKDIMEEITSMEGQYRYSVDQL
PVILDRLLHAGVGKILLFGIPAHKDIYGSQAYDQDGIVQRAIRLIREQYPGFYIVTDVCM
CEYTSHGHCGILDGEYVDNDRTLEYLNMIALSHAAAGAHMVAPSDMMDGRIGSMRAALDG
AGFVNVPIMAYSAKYASAFYGPFREAAGSAPAFGDRKSYQMDYHNRKEALKEVELDVAEG
ADLVMIKPALSYLDIIREVADRHDLPVAAYSVSGEYSMIKAASKAGFVDEEKVVCESAVS
IYRAGADILITYYAIELARYMDEGKIG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaattgatatacagaccgagaagattaagaacatcagataccttaagaagaatggtg
cgggaaacaagagtctcaaaagagtccctgatttatcccctgtttgttgtggaaggaaaa
gatataatggaagaaattacttccatggagggacaataccgttacagcgtggaccagctc
ccggtgatcctggaccggcttttacatgccggtgtgggaaaaatcctgctgtttggtatt
cctgcccataaagatatttacggcagccaggcatacgaccaggatggaattgtccagcgg
gccatccgcctgatcagagaacaatatccggggttctatattgtcacagatgtgtgcatg
tgtgaatatacctcccacggtcattgcgggatcctggatggagagtatgtggataatgac
aggactttggaatatttaaatatgattgcactttctcatgcagcagccggtgctcatatg
gtagccccttctgacatgatggacggacggattggttccatgagagcggctctggacggc
gcagggtttgtaaatgtgcctatcatggcttactccgccaagtatgcctccgcattttac
gggcctttccgggaggcggccgggtctgcaccggcttttggagaccggaagagctaccag
atggattatcataacaggaaagaggctttaaaggaagtggaactggatgtggcggaaggc
gctgatctggtgatgataaagcctgccctttcctatttggatatcataagagaggtggcg
gaccgccatgaccttcctgtagccgcatacagcgtaagcggagaatactccatgataaag
gcagcatccaaggcggggtttgtggacgaagaaaaggtggtatgcgaatctgcagtgagc
atataccgtgcaggggcggatattctcattacctactatgccatagagcttgcgcgatat
atggacgaagggaaaatcggctga

DBGET integrated database retrieval system