KEGG   Clostridium saccharolyticum WM1: Closa_1720Help
Entry
Closa_1720        CDS       T01288                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Closa_1720
  Lipid metabolism
   00600 Sphingolipid metabolism
    Closa_1720
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Closa_1720
Enzymes [BR:csh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Closa_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1834578..1837607
Genome map
AA seq 1009 aa AA seqDB search
MEQKTAKLEWLDDPRVFAVNRLAAHSDHSYYETEEEALKGNMELRQSLNGTWRFSFAENP
AARKEFFYEKDFNLDGFGTIEVPGHMELQGYGGCQYINTMYPWDGLADIRPPYTDKQNNP
VGSYVREFQLEEPLKEKRLYLSFQGVETAFYVWLNGTFIGYSEDSFTPSEFEITEAVLPG
TNRLAVEVYKRSSASWIEDQDFFRFSGIFRDVYLYAVPKCHVEDLFVHGDVSDDYRDGLF
RAELTLAGKTGGRISAVLKDRAGETAASWESVPSGKTVELTCRIPNVRLWSGEDPYRYEL
TITLYDEQGNGIEIVTQKVGFRRFELKDRLMCLNGKRVVFRGINRHEFNVRRGRSITKED
MMWDIRFMKRHNINAVRTCHYPDQSLWYELCDEYGIYLIDEANLESHGSWQKMGACEPSW
NVPGNLPEWKNCVVDRARSMLERDKNHPSILIWSCGNESYAGEDILAMSEFYKERDPSRL
VHYEGVFWNREYDRTSDMESRMYAKPWEVAEYLEKDPKKPFILCEYMHAMGNSLGGMKKY
TDLEDKYAMYQGGFIWDYIDQSLMKKDTYGREHMTYGGDFGDRPTDYSFCGNGIVYGDRT
ISPKAQEVKYLYQDIRLIPDSKGVSIENRRLFTDTSDLEFVYTVLKNGEPVYQKSFEAWV
KPLDTGYESVPVPDFTEPGEYVFQVSALLKSDALWADSGYETAFGEAVSVIEGHKEKCCG
LPLKVIHGDVNIGVMGEGFRILFSRQEGSIVSLVYDGNEWIGRPMMPVYWRATTDNDKGN
KFSVTSSVWYGAGKFPYYSNENCEVEEKEGSIKVTYTYELTTVPKASAEVTYEVNGRGTI
HVKAVFRGQKGLPELPAFGMRLITPETAKKFTWYGRGPEENYCDRNEGARLGIYEDTPDN
NLSRYLVPQECGNRTGVRWLKVSDMDGHSISFCASGQVFDASVLPYTAEELEAATHREEL
PVPRYTVVNILGAMRGVGGDDSWGAPVHQEYCISGEEELVTEFTIDRRS
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaaaaccgcaaaactggaatggctggatgatccacgggtcttcgcagtgaac
cgactggctgcccattccgatcactcctattacgagacagaagaggaagcgttaaaggga
aacatggagctgcgccagtccttaaacggcacatggagattttccttcgcggaaaatccc
gcagcaagaaaggaatttttctacgaaaaagattttaacctggacggctttggcaccatt
gaggttccgggtcatatggagcttcagggatacggcggctgccagtatatcaataccatg
tacccatgggatggtctggctgacatcaggcccccctatacggacaaacagaacaatccg
gtaggaagctatgtcagagagtttcaactggaagagccattgaaggaaaaacgtctgtac
ctgtcttttcagggagtggaaacggcattttacgtctggctgaacggtacctttatcggg
tattccgaggattcctttactccctctgaatttgaaataaccgaagcggttcttccaggt
accaaccgtctggccgtggaggtatataaaagaagcagtgcaagctggattgaggatcag
gactttttccggttctcagggattttccgggatgtatatttatatgcagttccaaaatgc
catgtggaggatttgtttgtccacggagatgtttcggatgattaccgggatggcctgttc
cgggcagaactgactctagccgggaaaaccggaggaaggatcagtgccgtattaaaagac
agggctggagagacggcagcgtcctgggaatccgtaccgtcagggaaaacggtggaatta
acctgccgtattcccaatgtccgtctgtggagcggagaagacccttaccgctatgaactt
accatcaccctatacgatgaacagggaaatggaatagagatcgttacgcagaaggtgggc
ttccgccgctttgaactgaaagaccgtttgatgtgtttaaacggaaagagggtggtattc
cggggaatcaaccgtcacgaatttaatgtaagaagaggccgttccattacaaaagaggac
atgatgtgggacatccggttcatgaagcggcacaatatcaatgcggtcagaacctgtcat
tatccagatcaaagcttatggtatgagctttgtgacgaatatggtatttatctcattgat
gaggcaaatttagaaagccatggttcctggcagaagatgggagcctgcgaaccttcctgg
aatgtgcccggaaaccttcctgagtggaagaattgcgtggtagaccgtgcaagatccatg
ttggaacgggataaaaaccatcccagcatcctgatctggtcctgcggcaatgagtcctat
gcaggtgaggacattctggccatgtcggagttttataaggagcgtgatccttccaggctg
gtccactatgagggtgtattctggaacagggagtatgaccggaccagtgatatggaaagc
cgcatgtatgcaaagccttgggaagtggcggaatatctggagaaggaccctaagaagcct
tttattctctgcgagtatatgcatgccatgggcaattctctgggaggcatgaagaaatat
acggatctggaagataagtacgccatgtaccagggtggatttatctgggattatatcgac
cagtctctgatgaagaaggatacatacggaagagagcacatgacatatggtggggacttt
ggagacaggcctacggattacagtttctgtggaaacgggatcgtctacggggacaggacc
atttcaccaaaggcccaggaggtgaaatacttgtatcaggacatccggctgatccctgat
tccaaaggtgtttccattgaaaacagaaggctgtttaccgatacctctgacttagagttt
gtctatacagtgttaaagaacggggaaccggtttatcaaaagagctttgaagcatgggta
aagcctttggatacaggatatgaatctgtcccggtaccggatttcacagagccgggagaa
tatgttttccaggtttcagctcttcttaaaagtgatgccttatgggctgattccggctat
gaaacagcctttggcgaggcagtttcagtaatagaaggacataaggaaaaatgctgcgga
ctgcctttgaaagtaattcatggcgacgtcaacatcggcgttatgggtgaggggttccgg
attctgttctccaggcaggaaggcagtatcgtttccctggtttacgacggaaacgaatgg
atcggaagaccgatgatgccggtatactggagggcgactacggataatgataaaggaaat
aaattttccgtgacaagctctgtgtggtatggggcaggaaagttcccttattacagcaat
gagaattgtgaggtggaagagaaggaaggaagcataaaggtgacctatacctatgagctt
accacggttcccaaggcatcagcagaggttacctacgaagtgaatggaaggggaacgatt
catgtaaaggccgtattccgggggcaaaagggattgccagagcttcctgcctttggaatg
aggcttatcacaccggaaacagccaagaaattcacttggtatggaagaggacctgaggaa
aattactgcgacaggaatgaaggagcgaggctagggatctatgaggatacgccggataac
aacctttcccgttatctggtacctcaggagtgcggtaacaggaccggagtccgctggctc
aaggtatcggacatggacggacattccatcagcttttgcgcatcaggccaggtgtttgat
gcttccgtactcccttatacggcggaggaactggaggcggctacccacagggaggagctt
ccggtaccaagatatacggtagtgaacattttaggtgccatgagaggagtcggcggtgat
gacagctggggagcaccggttcaccaggagtactgcataagtggggaagaagagcttgta
actgaatttacgatagatagaagatcataa

DBGET integrated database retrieval system