KEGG   Clostridium saccharolyticum WM1: Closa_1802Help
Entry
Closa_1802        CDS       T01288                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Organism
csh  Clostridium saccharolyticum WM1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1937020..1938048
Genome map
AA seq 342 aa AA seqDB search
MVLGQEKVSILNLPTPLEYLKNLSDELGIQLYLKRDDMTGLGMGGNKLRKLEYILKDALD
KGATMLITEGGVQTNHGRLTAAVAAKYNMRCGIVAIGDYPGELSANLLLDRLMGAEVIIK
KDDGRPSTVQYKELVNNTIKKYEAQGETVYYIPLGGSDDNGILGYYECAVELTSQAAAMG
IGDARVITAVGSLGTYMGLYCGFNNENSGLQLTGVAIMPFDHNKEQSIVKLFDRVKEAYG
MKINAGLKDFNIEKDYVRGGYNLPSREVREAVRLMAEKEAILLDPCYTGKCFAAIIDMMK
EGKIKKGEKIIMIHTGGMPGLYTKHHRVEFEKELIDGVTILD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggttttaggtcaggagaaagtctcaatattgaatttacccactcctttggaatatctt
aaaaatctttcagatgagttgggaatccaattatatcttaagcgtgatgatatgactggt
cttggtatgggaggcaataagcttcgtaagctggagtatatattaaaggatgcgctggac
aaaggagccacaatgctcattacggagggcggagtacaaacaaatcatggccggttaacg
gctgctgtggctgctaaatacaatatgaggtgcgggattgttgcgatcggggattaccct
ggtgaattgtcggcaaacttactattggaccggttaatgggtgctgaagtaatcataaaa
aaagatgatggacgtccatcaacggtacagtataaagagttggttaataataccatcaaa
aaatatgaagcacagggagaaaccgtttattatataccccttggcggttccgatgataac
ggtatccttggttactatgaatgtgcggttgagcttaccagccaggcggctgccatggga
atcggtgatgcacgggtcataactgcagtaggcagtctggggacctacatgggtctgtac
tgcgggtttaataatgaaaattccggactgcaattaaccggtgtagcgattatgccgttt
gatcataacaaagagcagagcattgttaagctgtttgacagagtaaaagaagcatatgga
atgaaaataaacgctgggttaaaagattttaatattgaaaaagattatgtccggggagga
tataaccttccttcaagggaagtcagggaggcggtgcgtctgatggctgaaaaagaagcc
attttacttgatccgtgttacacaggaaaatgtttcgccgcaatcattgatatgatgaag
gaagggaagattaaaaaaggtgagaagatcatcatgattcatacaggggggatgcctgga
ttatacacaaagcatcatagagtggaatttgaaaaggaattaattgatggggttacaatt
cttgattga

DBGET integrated database retrieval system