KEGG   Clostridium saccharolyticum WM1: Closa_1802Help
Entry
Closa_1802        CDS       T01288                                 

Definition
(RefSeq) 1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Closa_1802
Enzymes [BR:csh01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Closa_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1937020..1938048
Genome map
AA seq 342 aa AA seqDB search
MVLGQEKVSILNLPTPLEYLKNLSDELGIQLYLKRDDMTGLGMGGNKLRKLEYILKDALD
KGATMLITEGGVQTNHGRLTAAVAAKYNMRCGIVAIGDYPGELSANLLLDRLMGAEVIIK
KDDGRPSTVQYKELVNNTIKKYEAQGETVYYIPLGGSDDNGILGYYECAVELTSQAAAMG
IGDARVITAVGSLGTYMGLYCGFNNENSGLQLTGVAIMPFDHNKEQSIVKLFDRVKEAYG
MKINAGLKDFNIEKDYVRGGYNLPSREVREAVRLMAEKEAILLDPCYTGKCFAAIIDMMK
EGKIKKGEKIIMIHTGGMPGLYTKHHRVEFEKELIDGVTILD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggttttaggtcaggagaaagtctcaatattgaatttacccactcctttggaatatctt
aaaaatctttcagatgagttgggaatccaattatatcttaagcgtgatgatatgactggt
cttggtatgggaggcaataagcttcgtaagctggagtatatattaaaggatgcgctggac
aaaggagccacaatgctcattacggagggcggagtacaaacaaatcatggccggttaacg
gctgctgtggctgctaaatacaatatgaggtgcgggattgttgcgatcggggattaccct
ggtgaattgtcggcaaacttactattggaccggttaatgggtgctgaagtaatcataaaa
aaagatgatggacgtccatcaacggtacagtataaagagttggttaataataccatcaaa
aaatatgaagcacagggagaaaccgtttattatataccccttggcggttccgatgataac
ggtatccttggttactatgaatgtgcggttgagcttaccagccaggcggctgccatggga
atcggtgatgcacgggtcataactgcagtaggcagtctggggacctacatgggtctgtac
tgcgggtttaataatgaaaattccggactgcaattaaccggtgtagcgattatgccgttt
gatcataacaaagagcagagcattgttaagctgtttgacagagtaaaagaagcatatgga
atgaaaataaacgctgggttaaaagattttaatattgaaaaagattatgtccggggagga
tataaccttccttcaagggaagtcagggaggcggtgcgtctgatggctgaaaaagaagcc
attttacttgatccgtgttacacaggaaaatgtttcgccgcaatcattgatatgatgaag
gaagggaagattaaaaaaggtgagaagatcatcatgattcatacaggggggatgcctgga
ttatacacaaagcatcatagagtggaatttgaaaaggaattaattgatggggttacaatt
cttgattga

DBGET integrated database retrieval system