KEGG   Clostridium saccharolyticum WM1: Closa_1915Help
Entry
Closa_1915        CDS       T01288                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Closa_1915
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_1915
   00052 Galactose metabolism
    Closa_1915
   00500 Starch and sucrose metabolism
    Closa_1915
   00520 Amino sugar and nucleotide sugar metabolism
    Closa_1915
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Closa_1915
   00524 Butirosin and neomycin biosynthesis
    Closa_1915
Enzymes [BR:csh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Closa_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2067064..2068017
Genome map
AA seq 317 aa AA seqDB search
MHIIGFDIGGTKCAVLLCRLEGEHVIWYDRMETQTTPDWKAVLDALCSHADEMLKVYGVC
RSDCCIGISCGGPLSRDRTVISSPPNLPGWDSVPVTAYLSEKLMMPARMLNDADACALAE
WKYGAGKGSLHMIFLTFGTGLGAGLILNGRLYTGACGMAGEVGHVRLTEDGPVGYGKKGS
LEGFCSGGGIRQMAIKKAEQMEREGEKASFQTGNKESVKAKDVVEAARAGHEDAAELLRE
SGAYFGKGLSILIDILNPEVIVAGSIYARSHEFLETAMWEEIRREALASSAAACRIVPAL
LGERIGDYGAVMAAVYE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcataggatttgatattggaggaaccaagtgtgcggttctgctttgccgtttg
gagggggagcatgttatatggtatgaccgtatggaaacacagacaacaccagactggaaa
gcggttttagatgccttatgcagccatgcggatgaaatgctgaaggtttatggagtctgc
cggtcagactgctgtatcggtatctcctgcggaggaccattaagccgggacagaacggtc
atcagttcaccgccaaacctgccgggctgggattctgttcctgtaacagcttacctgtcg
gaaaagcttatgatgcctgccagaatgttaaatgatgccgatgcctgcgcccttgctgaa
tggaagtatggggccggaaagggatcgcttcatatgatatttctgacctttggcaccgga
cttggagcaggacttattctgaacggccgtttgtatacgggggcatgcggcatggcagga
gaagtgggccatgtccgcctgacagaggatggaccggtgggatacggaaagaaaggaagt
ctggagggattttgcagcggcgggggaatccgtcagatggccataaaaaaagcggagcag
atggaaagagagggggaaaaagcctccttccagacgggaaataaggaatccgtaaaagca
aaggatgtggtggaggccgccagggcaggtcacgaggatgccgcagaattgctaagggag
tcgggagcatattttgggaaaggactgtccatacttatcgatatcctgaatccggaggtg
atagtggccggaagcatatatgccagaagccacgaatttctggaaacagccatgtgggag
gagatccgcagggaggctcttgcctcatcggcggctgcgtgcaggattgtaccagccctt
cttggggagcggatcggagactatggagctgttatggctgcggtctatgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system