KEGG   Clostridium saccharolyticum WM1: Closa_1989Help
Entry
Closa_1989        CDS       T01288                                 

Definition
(GenBank) class II aldolase/adducin family protein
Organism
csh  Clostridium saccharolyticum WM1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2143453..2144151
Genome map
AA seq 232 aa AA seqDB search
MLETLKKEVCEIAKRAQRDGLCKHKSGNFSARDLASGFVVITPTSVDRDLLTPRDMVVMD
LEANVVENLSGLRPTSETLMHLMIYRQRPKASAVAHTHSPYATAFALLNKPLPAIVYEVA
NLGLTKARVPVAPYGRPGTTGLAESVIESCLEADCFLLEKHGAVAVDERNIYEAFLKAAY
IEELAELYYLALTANGGNEPEGFGPEELQRWEYPKEISFLKEREKSISTGTA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaacattaaaaaaggaagtgtgtgaaatcgcaaagcgggctcagagagatggt
ttgtgcaaacataaatccgggaatttcagcgctcgggatctggcgtctggttttgtggtc
atcacccctaccagtgtagaccgggacttactgaccccaagagatatggtggtcatggac
ttagaggccaatgtggtagaaaatttatcaggtttaagacccaccagcgaaaccctgatg
catctgatgatttaccgccaaaggccgaaagcgtctgccgttgcccatacacactcacca
tatgccactgcatttgccctgctgaacaagccccttccggctattgtatatgaagtggct
aatttaggcctgacaaaagccagggtcccggtggctccttatggacgtccgggcaccaca
ggtctggcagaaagtgtcattgaaagctgtttggaagcggactgttttttattggaaaag
cacggagcagttgcagttgatgaacggaatatttatgaggcgtttttaaaggctgcctac
attgaggaacttgctgaattatattatcttgcattgacggcaaacgggggaaatgagccg
gaaggttttggaccggaggagctgcaaaggtgggaatatcccaaagagatctcattcctt
aaggaaagagaaaaatcaatttccactggtactgcctga

DBGET integrated database retrieval system