KEGG   Clostridium saccharolyticum WM1: Closa_2062Help
Entry
Closa_2062        CDS       T01288                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00330  Arginine and proline metabolism
csh00332  Carbapenem biosynthesis
csh01100  Metabolic pathways
csh01130  Biosynthesis of antibiotics
csh01230  Biosynthesis of amino acids
Module
csh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Closa_2062
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Closa_2062
Enzymes [BR:csh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Closa_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Succ_CoA_lig MlaC
Motif
Other DBs
NCBI-ProteinID: ADL04641
JGI: Closa_2062
UniProt: D9R194
Position
complement(2218464..2219327)
Genome map
AA seq 287 aa AA seqDB search
MNTWEREKLKDKKRIVIKIGSSSLTHAYTGDLNLMKIEKLVRVISDLKGQGKEVVLVSSG
AIAAGRQALGHHTKPVTISEKQAYAAVGQARLMMVYQKLFAEYNQIAAQVLLTKNTMVND
SSRYNAQNTFDELLKLGTIPIVNENDTVSTSEIPLVDNFGDNDRLSAIVAALIGADLLIL
LSDIDGLYSDDPRQNPDAEFIGLVREITPKLLDMGKSTSGSDVGTGGMAAKLAAARIATD
SGSDMVIANGDQVDVIGQIVEGEVKGTLFLAHPNHDFDLMDYINHEY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctgggaacgagagaaactaaaggataaaaaaaggattgtaattaaaattgga
tcctcttccttaacacatgcctataccggggacttaaacctgatgaaaatcgagaaactg
gttcgggtaatcagcgatttaaaaggacagggaaaagaggtggttttggtttcctccggt
gctattgcagcaggacgccaggctctgggtcatcataccaagcccgtaactatatcggaa
aaacaggcatatgcagccgtaggccaggccaggcttatgatggtgtaccagaagctcttt
gcagaatataatcaaatagctgcacaggttcttttaaccaaaaatactatggttaatgac
agcagccgatacaacgcccagaatacctttgatgaacttttaaagctgggaaccatcccc
attgtcaatgaaaatgataccgtatccacttccgaaattcccctggtggataattttggt
gataatgaccggctatccgctattgttgccgcattgatcggagcggatcttcttatctta
ttatcggatatcgacggcctttattctgatgaccccaggcaaaatccagacgcagaattt
atcggactggtaagggaaatcacgccaaagcttcttgatatggggaaatccacctctgga
agcgatgtgggcaccggaggaatggccgcaaagctggcagccgcccgcattgccacggac
agcggttctgatatggtcattgcaaacggagatcaggtggatgtcattgggcagatcgtg
gagggagaagtaaaagggaccttgttcctggcccatccaaaccatgactttgatttaatg
gactatattaatcatgagtattaa

DBGET integrated database retrieval system