KEGG   Clostridium saccharolyticum WM1: Closa_2185Help
Entry
Closa_2185        CDS       T01288                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Closa_2185
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Closa_2185
Enzymes [BR:csh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Closa_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2350035..2350949
Genome map
AA seq 304 aa AA seqDB search
MRHLLNPLDFSVEETGQLLDLAKDIEENLPKYSHVCDGKKLATLFYEPSTRTRLSFEAAM
LNLGGSVLGFSSADSSSAAKGESVADTIRVLSCYADICAMRHPKEGAPLVAANHSSIPVI
NAGDGGHQHPTQTLTDLLSIRSLKGRLNDLTIGLCGDLKFGRTVHSLINALVRYENIKFI
LISPPELRVPEYIREDVLKANNIEFMEMDSLDEAMPSLDILYMTRVQKERFFNEEDYIRL
KDCYILDKKKMKLAKQDMYVLHPLPRVNEISVEIDEDPRAAYFKQAKYGVYVRMALIMTL
LEVK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagacatttacttaacccgttagactttagtgtggaagagacagggcagcttttggat
ctggccaaagatatcgaagaaaatcttccaaaatattctcatgtatgcgatggaaaaaaa
ttagcgacattattttatgagccaagtacaagaactcgtttgagtttcgaggctgccatg
ttgaatctgggcggcagtgtactaggcttttcttctgctgactccagttctgccgcaaaa
ggagaaagtgttgctgacaccattcgggtcctttcctgctacgcagacatatgtgccatg
agacatcccaaagaaggagctccgctggttgctgctaaccattccagcataccggtaatc
aatgccggagacggaggacaccagcatccgacccagacccttactgatcttctttccata
cgttctttaaaaggccgcttaaatgatctgaccatcggcctctgcggtgatttaaaattc
ggccgaacggtccactctctgattaatgctcttgtacgatacgaaaacattaaattcatc
ttgatttctccccctgaactgcgagtacctgaatacatccgtgaagatgtgttaaaggcc
aacaacatcgaatttatggaaatggacagccttgacgaagcgatgccgtctcttgatatc
ctgtacatgacccgtgtgcaaaaggagcgcttctttaatgaagaggattacatccgtttg
aaggactgttatattctggacaaaaagaaaatgaaactggcaaaacaagatatgtatgtt
cttcacccccttccaagagtcaacgaaatttccgtggagattgacgaagatcccagagcc
gcctactttaagcaggcgaaatacggcgtgtatgtgcgcatggcccttatcatgacatta
ttggaggtaaaataa

DBGET integrated database retrieval system