KEGG   Clostridium saccharolyticum WM1: Closa_2238Help
Entry
Closa_2238        CDS       T01288                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Closa_2238
Enzymes [BR:csh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Closa_2238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2410765..2411373)
Genome map
AA seq 202 aa AA seqDB search
MISFIKGPLAEIFEDTVVIESGNVGFEIHAPLSVLEKLPGIGVEIKLYTYFQVREDAMCL
FGFLNRQDLQMFQQLISVNGIGPKGALGILSALRPEELRRAIISGDAKAISKAPGVGAKT
AQRIILDLKDKIDLAEILPSGFTESADKVILSGGVTEEALEALTALGYSAAEAGRAVRQV
EVTESMTVEDVLKASLKHLAFI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcttttataaaggggcctctggccgaaatatttgaagataccgttgtaatagaa
agcgggaacgtgggatttgagatacatgctcccttatctgtacttgaaaaattgccggga
atcggggttgagataaaactgtatacatattttcaggtaagagaggatgccatgtgcctt
tttggttttttaaaccgccaggatctgcagatgtttcagcagctcataagcgttaatggg
ataggtcctaagggtgccttgggaattctttctgccttaaggcctgaggagttacgaaga
gctattatttccggggatgccaaggccatttccaaagcaccgggagtcggggcgaagacg
gctcaaaggatcatattggatttaaaggataaaatagatttggctgagattcttccttcc
gggtttacggagtcagcagacaaggttattttgtccggcggggtaacagaggaagccctg
gaggcactgacagctcttggctattctgcagctgaggctggcagggcggtccgtcaggtg
gaagtaacagagtccatgacagtggaagatgtgcttaaggcttccttaaagcatttggca
ttcatatag

DBGET integrated database retrieval system