KEGG   Clostridium saccharolyticum WM1: Closa_2274Help
Entry
Closa_2274        CDS       T01288                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:csh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:csh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:csh00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:csh00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:csh00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:csh00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:csh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2444783..2446000
Genome map
AA seq 405 aa AA seqDB search
MKKNAIVGQSGGPTAVINASLYGVIKEGMAQAGVSRVYGMINGIEGFMSDNYMDLSNDLT
EEELELLKLTPAAYLGSCRYKLPDNLSSPLYPALFEKFRALEIGYFFYIGGNDSMDTVSK
LSRYAAHHNSIIRFIGIPKTIDNDLILTDHTPGYGSAAKYVADTVREIVLDSSVYQQKSV
TIIELMGRHAGWLTAASALARKFKGDNPVLIYLPETDFDFERFASDVKAALNKHSTVIIC
ISEGLSDAKGKFICEYADEVRLDTFGHKMLTGSGKMLENFVRDRFGVKVRSIELNVNQRC
SGMLASATDIEESVQAGSQGVKAALNGFTGKMVAFCRTGNSPYSMECTTVDVNQVCNQEK
LFPAQWICSNGTDVTPDFLEYVLPLIQGEPNRKIENGRPVYLYRK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatgcaatcgtaggacaatccggcggaccaaccgctgtgatcaatgcaagc
ctttacggcgtcattaaggaaggaatggctcaggctggtgtcagccgggtttacggtatg
atcaacggcatagaaggcttcatgtccgataattatatggatttatcaaacgacttaacg
gaagaagaactggagctgctgaaactaacacctgctgcttatttaggctcctgccggtat
aagctccctgacaatctgtcttctcccctttatccggctctgtttgaaaaattccgggcc
ttggaaattggatatttcttttacatcggcggaaatgattctatggacacggtaagcaag
ctttcccgctatgccgcccatcacaacagcatcatccgttttatcggaattcccaaaacc
attgacaatgacttgattttaacggatcatacacccggatacggcagcgctgccaaatat
gtggcagatactgtccgggaaatcgtcctggattcttctgtttaccagcaaaaatcagtc
accattatagaactgatgggccgtcatgccggatggctcactgccgccagtgccctggcc
agaaagtttaagggggataatccagtacttatctaccttcctgaaacggattttgatttt
gaacggtttgcatcggatgtaaaggccgcccttaataagcatagtaccgttattatctgt
atctcagagggactctctgatgccaagggtaaattcatctgcgagtatgccgatgaagtc
cgtttagacaccttcggccataaaatgctcaccggcagcggtaaaatgctggagaatttt
gtccgtgaccgattcggcgtaaaggttcgttccattgaactgaacgtaaaccagagatgc
agcggtatgctggcctctgctactgatatagaagaatctgttcaggcaggctcgcaaggg
gtaaaagcagctttaaacggctttaccggaaaaatggtggccttttgccgcacaggtaac
tctccttattctatggaatgtactacggttgatgtcaaccaggtatgcaatcaggaaaaa
ctcttcccagcccaatggatctgcagcaatggtaccgatgttactccggactttctggaa
tatgtactgcctttgatccagggagagcccaatcgaaaaatagaaaacggcagaccggta
tatctgtaccggaaatga

DBGET integrated database retrieval system