KEGG   Clostridium saccharolyticum WM1: Closa_3273Help
Entry
Closa_3273        CDS       T01288                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Closa_3273
  Amino acid metabolism
   00300 Lysine biosynthesis
    Closa_3273
Enzymes [BR:csh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Closa_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3516919..3518109)
Genome map
AA seq 396 aa AA seqDB search
MEKEGWEKESWEREAVQLLQDLIGIRTVNGKDGEKPAAEYICQYLNSRGVEAFVQDIGEG
RGNVIALIQGAHEGKGMIWNGHLDTVDYGSLESWDRPPWTPVMENGCLFGRGASDMKSGL
AAMVYVLGKLGETGQKPGTTIQFLGTCDEERGGTGARAIISGGYMMEGSVLLIGEPTGCT
VGIGQKGCIWLELEVKGKTSHGAYPEEGCNAVSCAYEAAECLGNWIRLHDHPVLGRATAQ
ITEIQGGIQPNMTPDLCTVLMDIRTVPGLTCESILSRLETIFQDISRKYGGIPGLVPRIK
NHRISIEADKASLGVATLVKSMEAAGIPEAYSGISYFTDASILAEGREGLTTLLFGPGSA
DMAHKPNECVRIPDYLRAIGALTNMAAVRIEDESNN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggaaggctgggaaaaggaaagctgggaaagggaagcggtacagcttttacag
gatttaatagggatcaggacagtcaacggcaaagacggagaaaagccggcagcagaatat
atctgccaatacttaaacagccgcggggtggaggcctttgtccaggatataggagaagga
aggggcaacgtcattgccctgatccagggagcgcatgaaggaaagggaatgatctggaac
ggacatcttgatacggtggattacggttcactggagagctgggacaggccgccctggaca
cctgtgatggaaaacggctgcctcttcgggcggggagccagtgatatgaagagcggactg
gctgccatggtatatgttctgggaaagctgggggagaccgggcagaagcctgggacaaca
atccagtttcttggaacatgtgacgaagagcggggaggaaccggggcaagggcaattatt
tccggcggatatatgatggaagggtcggttttactgatcggagaacccaccggctgtacc
gtggggatcggacaaaagggctgtatctggctggagttggaggtaaaaggcaagaccagt
catggggcatatccggaagagggctgcaatgcagtctcctgtgcatacgaagctgcggaa
tgtctgggaaattggatccgcctccacgaccatccggtccttggtagggcaaccgcccag
atcacggaaatacagggaggaatacagccaaacatgacgcctgatctgtgtacggtttta
atggatatccgtacggtgcccggacttacctgtgaaagtattctcagccggctggagacc
atatttcaggatatcagccggaaatacggtggaatccccggtctggttcccaggattaag
aatcacagaattagcattgaagcggacaaggcttctttaggtgttgcaacgcttgtaaaa
agcatggaggcagccgggattccggaagcctattccggaatctcctattttacagacgct
tccatactggcagaaggaagagaagggctgacaacccttttatttggaccaggatcggcg
gatatggcgcacaagcccaatgaatgtgtacgaatcccggattacctcagggcaatagga
gcattgaccaatatggcagcagtgaggattgaggatgagagcaacaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system