KEGG   Clostridium saccharolyticum WM1: Closa_3273Help
Entry
Closa_3273        CDS       T01288                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00300  Lysine biosynthesis
csh01100  Metabolic pathways
csh01120  Microbial metabolism in diverse environments
csh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Closa_3273
Enzymes [BR:csh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Closa_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADL05802
JGI: Closa_3273
UniProt: D9R8S3
Position
complement(3516919..3518109)
Genome map
AA seq 396 aa AA seqDB search
MEKEGWEKESWEREAVQLLQDLIGIRTVNGKDGEKPAAEYICQYLNSRGVEAFVQDIGEG
RGNVIALIQGAHEGKGMIWNGHLDTVDYGSLESWDRPPWTPVMENGCLFGRGASDMKSGL
AAMVYVLGKLGETGQKPGTTIQFLGTCDEERGGTGARAIISGGYMMEGSVLLIGEPTGCT
VGIGQKGCIWLELEVKGKTSHGAYPEEGCNAVSCAYEAAECLGNWIRLHDHPVLGRATAQ
ITEIQGGIQPNMTPDLCTVLMDIRTVPGLTCESILSRLETIFQDISRKYGGIPGLVPRIK
NHRISIEADKASLGVATLVKSMEAAGIPEAYSGISYFTDASILAEGREGLTTLLFGPGSA
DMAHKPNECVRIPDYLRAIGALTNMAAVRIEDESNN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggaaggctgggaaaaggaaagctgggaaagggaagcggtacagcttttacag
gatttaatagggatcaggacagtcaacggcaaagacggagaaaagccggcagcagaatat
atctgccaatacttaaacagccgcggggtggaggcctttgtccaggatataggagaagga
aggggcaacgtcattgccctgatccagggagcgcatgaaggaaagggaatgatctggaac
ggacatcttgatacggtggattacggttcactggagagctgggacaggccgccctggaca
cctgtgatggaaaacggctgcctcttcgggcggggagccagtgatatgaagagcggactg
gctgccatggtatatgttctgggaaagctgggggagaccgggcagaagcctgggacaaca
atccagtttcttggaacatgtgacgaagagcggggaggaaccggggcaagggcaattatt
tccggcggatatatgatggaagggtcggttttactgatcggagaacccaccggctgtacc
gtggggatcggacaaaagggctgtatctggctggagttggaggtaaaaggcaagaccagt
catggggcatatccggaagagggctgcaatgcagtctcctgtgcatacgaagctgcggaa
tgtctgggaaattggatccgcctccacgaccatccggtccttggtagggcaaccgcccag
atcacggaaatacagggaggaatacagccaaacatgacgcctgatctgtgtacggtttta
atggatatccgtacggtgcccggacttacctgtgaaagtattctcagccggctggagacc
atatttcaggatatcagccggaaatacggtggaatccccggtctggttcccaggattaag
aatcacagaattagcattgaagcggacaaggcttctttaggtgttgcaacgcttgtaaaa
agcatggaggcagccgggattccggaagcctattccggaatctcctattttacagacgct
tccatactggcagaaggaagagaagggctgacaacccttttatttggaccaggatcggcg
gatatggcgcacaagcccaatgaatgtgtacgaatcccggattacctcagggcaatagga
gcattgaccaatatggcagcagtgaggattgaggatgagagcaacaattaa

DBGET integrated database retrieval system