KEGG   Clostridium saccharolyticum WM1: Closa_3281Help
Entry
Closa_3281        CDS       T01288                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Closa_3281
Enzymes [BR:csh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Closa_3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3526172..3528070
Genome map
AA seq 632 aa AA seqDB search
MTIKEIARLAGVSISTVSKIVNNKDKNISPETRDRVLKIVKDYHYTPYSTVKNNPEAKTF
MIGLLLMSMEKTGQMINGIITAAQKSGYSILIYDSMNRSENELKHITSLCKNHVDGVIWE
PVNENSLEHKHYFEEQGIEVCRINCREDPFSCFIDFAGMGYAATEILIRHGHTKLGCLTK
QNSLRSGMVVEGFKKCLFNHSIPFNSSMILPLESEDWYNGILTHTPTGIISTHYTSALIL
MEHMAKLKIQVPSDLSLISLRDDGRETIAFPGISSIRIPYYEFGTFVCKRLIETCEKREE
ESSAFQVDFPLENTQSLGLPFTSNGKKIVVVGSVNIDVTLNVDELPQPGRTVCTSRHSVI
PGGKGANQAVGAAKLGNEVSLIGKVGSDYDSNLIYTCMEENRVDVMGLKRDAHAETGKAY
IHVQDDGESMITILTGANQKLRPEDIVFHERAFEHSGYCLLQTEVPEDAIETAAGLAKKY
GAKNILKPAAMKSIRPSLMKLIDIFVPNRKEAELLCPTIPDVEGKAAEFIKQGAKTVIIT
LGHSGCYIKDPSFKGYLPASPFPPVDTTGAADAFIAALAAYLSSGYSMEASARIAAYAAG
FCVSRQGVIPSLIDRNSLETYINRIEPELMKQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaaggaaatcgcccggctggcaggtgtatcaatatccactgtatcaaaaata
gtaaacaacaaagataaaaacataagccctgagaccagagaccgggtccttaaaatcgta
aaagactatcattataccccgtacagtacggtgaaaaataatccagaggcaaaaaccttt
atgatcggcctcctccttatgtccatggagaaaaccggccagatgataaacggcatcata
accgcagctcaaaaaagcggctacagtattttgatttatgacagcatgaaccgttcagaa
aatgaactgaagcatattacctccctatgcaaaaatcatgttgacggggtcatatgggag
ccggtaaacgaaaacagcctggaacataagcattactttgaggaacagggcatagaggtc
tgcaggatcaactgcagagaggatcctttttcctgtttcattgattttgcaggcatggga
tatgctgctactgaaatcctgatccgccatgggcacacaaagctgggctgtctcacgaag
cagaacagcctgcggtctggcatggttgtggaagggtttaagaaatgcctgttcaaccac
agcatcccttttaacagctccatgatccttcctcttgaatcagaagactggtacaacggc
atattgacccacaccccgaccggaatcatcagtacccattatacgtcggctcttattctc
atggagcatatggcaaagcttaagattcaggttccatcggatctctcccttataagctta
agagatgatgggcgtgagaccattgctttcccaggcatttccagcatccgtatcccttat
tacgaattcgggacatttgtctgcaaacgtcttattgaaacatgcgagaaacgggaagag
gaatcttctgcctttcaggtggattttccactggaaaatacacagagccttggcctcccc
tttacctccaacggaaaaaaaatcgtggtggttggaagcgttaacatcgatgtaacctta
aacgtagacgaacttccccagccgggacggaccgtctgtaccagcaggcattccgttatt
ccggggggaaaaggagccaatcaggccgttggcgctgcaaagctgggaaatgaggtttct
ctcatcgggaaggttggaagcgattatgattccaacttaatatatacttgcatggaagaa
aacagggtagatgttatgggtttaaaaagagatgcccatgcagaaactggaaaagcctat
atccatgtccaggatgacggggaaagcatgatcacaatcctcaccggagccaaccagaaa
ctgagacctgaggacattgtctttcatgaaagggccttcgagcattccggttactgtctg
cttcaaaccgaagttcctgaagatgccatagaaacggctgccggactggcaaaaaaatat
ggagcaaaaaatattttaaagcctgctgccatgaagtctatccgcccttcccttatgaag
ctgattgatatcttcgtaccgaatcggaaagaagcagaacttttgtgccctacgattcca
gatgtggaaggaaaagctgctgaattcataaaacagggggcaaagacggtgatcatcacc
ctggggcattccggctgttatattaaggatccctcctttaagggatatctgcctgcatcc
ccttttcctcctgtggataccactggagctgcagatgctttcattgcggccctggctgcc
tatttatcatcaggttattccatggaagcatctgccagaatcgccgcttacgccgcaggc
ttctgtgtatccaggcaaggggtcatcccttcgctcattgacaggaattcccttgaaact
tatattaacaggattgagccggaattgatgaagcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system